KEGG   Escherichia coli K-12 MG1655: b1652Help
Entry
b1652             CDS       T00007                                 

Gene name
rnt
Definition
(RefSeq) RNase T; exoribonuclease T; structured DNA 3' exonuclease; RNA processing; DNA repair
  KO
K03683  ribonuclease T [EC:3.1.13.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     b1652 (rnt)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    b1652 (rnt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051
Motif
Other DBs
NCBI-GeneID: 946159
NCBI-ProteinID: NP_416169
Pasteur: rnt
RegulonDB: ECK120001501
ECOCYC: EG11547
ASAP: ABE-0005523
UniProt: P30014
Structure
PDB: 

Jmol
Position
1728347..1728994
Genome map
AA seq 215 aa AA seqDB search
MSDNAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHF
HVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAH
NANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQA
HSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataacgctcaacttaccggtctgtgcgaccgttttcgtggtttttatcctgtt
gtgatcgatgttgaaacagccggatttaacgccaaaaccgatgcgctgcttgagattgcc
gccatcaccctgaaaatggatgaacaaggctggctgatgccggacaccacattacatttc
cacgtcgaaccatttgtcggcgcaaatttgcaaccagaagccctcgccttcaacggcatt
gacccgaacgatcccgatcgcggcgcggtcagcgaatacgaggcgctgcacgaaattttt
aaagttgtacgtaaaggtattaaagcgagcggctgtaaccgcgccattatggtggcgcac
aatgccaattttgatcacagctttatgatggccgccgcagaacgcgcctcactgaaacgt
aacccgttccaccctttcgccacttttgacactgctgcactggccgggctggcactcgga
caaaccgtattgtcaaaggcttgccagaccgctggcatggacttcgacagcacccaggcg
cactccgcgctgtacgacaccgaacgcactgctgtgctgttttgtgaaatcgtcaaccgc
tggaaacgtctgggaggctggccgctatctgccgccgaagaggtgtaa

DBGET integrated database retrieval system