KEGG   Escherichia coli K-12 MG1655: b1652Help
Entry
b1652             CDS       T00007                                 

Gene name
rnt
Definition
(RefSeq) ribonuclease T (RNase T) (EC:3.1.13.-)
  KO
K03683  
ribonuclease T [EC:3.1.13.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     b1652 (rnt)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    b1652 (rnt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1728347..1728994
Genome map
AA seq 215 aa AA seqDB search
MSDNAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHF
HVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAH
NANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQA
HSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataacgctcaacttaccggtctgtgcgaccgttttcgtggtttttatcctgtt
gtgatcgatgttgaaacagccggatttaacgccaaaaccgatgcgctgcttgagattgcc
gccatcaccctgaaaatggatgaacaaggctggctgatgccggacaccacattacatttc
cacgtcgaaccatttgtcggcgcaaatttgcaaccagaagccctcgccttcaacggcatt
gacccgaacgatcccgatcgcggcgcggtcagcgaatacgaggcgctgcacgaaattttt
aaagttgtacgtaaaggtattaaagcgagcggctgtaaccgcgccattatggtggcgcac
aatgccaattttgatcacagctttatgatggccgccgcagaacgcgcctcactgaaacgt
aacccgttccaccctttcgccacttttgacactgctgcactggccgggctggcactcgga
caaaccgtattgtcaaaggcttgccagaccgctggcatggacttcgacagcacccaggcg
cactccgcgctgtacgacaccgaacgcactgctgtgctgttttgtgaaatcgtcaaccgc
tggaaacgtctgggaggctggccgctatctgccgccgaagaggtgtaa

DBGET integrated database retrieval system