KEGG   Escherichia coli K-12 MG1655: b1653Help
Entry
b1653             CDS       T00007                                 

Gene name
lhr
Definition
(RefSeq) putative ATP-dependent helicase
  KO
K03724  
ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     b1653 (lhr)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    b1653 (lhr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1729087..1733703
Genome map
AA seq 1538 aa AA seqDB search
MADNPDPSSLLPDVFSPATRDWFLRAFKQPTAVQPQTWHVAARSEHALVIAPTGSGKTLA
AFLYALDRLFREGGEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKGIADERRRRG
ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDE
VHAVAGSKRGAHLALSLERLDALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPA
MRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPYIETGILDEVLRHRSTIVFTN
SRGLAEKLTARLNELYAARLQRSPSIAVDAAHFESTSGATSNRVQSSDVFIARSHHGSVS
KEQRAITEQALKSGELRCVVATSSLELGIDMGAVDLVIQVATPLSVASGLQRIGRAGHQV
GGVSKGLFFPRTRRDLVDSAVIVECMFAGRLENLTPPHNPLDVLAQQTVAAAAMDALQVD
EWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFSAFRPKLVWNRETGILTARPGAQL
LAVTSGGTIPDRGMYSVLLPEGEEKAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI
TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLAEEN
TIANIQGLIEEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWAVAIAGR
IHALWGADASVVASDDGIVARIPDTDGKLPDAAIFLFEPEKLLQIVREAVGSSALFAARF
RECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPVILETLRECLQDVYDLPA
LERLMRRLNGGEIQISDVTTTTPSPFATSLLFGYVAEFMYQSDAPLAERRASVLSLDSEL
LRNLLGQVDPGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRH
TGSSEEVASYLENLLAVKRIFPAMISGQERLACMDDAARLRDALGVRLPESLPEIYLHRV
SYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMNLQQDIWVSDEV
FRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPALFASTSPGVYEGVDGVM
RVIEQLAGVGLPASLWESQILPARVRDYSSEMLDELLATGAVIWSGQKKLGEDDGLVALH
LQEYAAESFTPAEADQANRSALQQAIVAVLADGGAWFAQQISQRIRDKIGESVDLSALQE
ALWALVWQGVITSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPVSPRVSYNTPN
LAGRWSLLQVEPLNDTERMLALAENMLDRYGIISRQAVIAENIPGGFPSMQTLCRSMEDS
GRIMRGRFVEGLGGAQFAERLTIDRLRDLATQATQTRHYTPVALSANDPANVWGNLLPWP
AHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKEELLAPEVFHALTTALRREP
RLRFTLTEVNDLPVRQTPMFTLLREAGFSSSPQGLDWG
NT seq 4617 nt NT seq  +upstreamnt  +downstreamnt
atggcagataatccagacccttcatcgctcctgccggacgtgttttcaccggcgacccgc
gactggtttcttcgcgcctttaaacagccgaccgctgtccagccgcaaacctggcatgtg
gcggcgcgaagcgaacatgcgctggtgattgcaccgaccggctccgggaaaacgctggca
gcatttctctacgccctcgatcggctcttccgcgaaggcggcgaagatacccgcgaggcg
cataagcgtaaaacctcacgcatcctctatatttcaccgataaaagccctgggcaccgac
gttcagcgcaacttgcagatcccgttgaagggtattgccgatgaacggcggcggcgcggc
gaaacggaagtcaatcttcgcgtagggatccgtactggcgatacgcctgcacaggaacgc
agcaaactcacccgtaatccgccggatattctgatcaccacacccgaatcactctatctg
atgctgacctcccgcgcgcgcgaaacgctacgcggcgtcgaaacggtaattattgatgaa
gtccacgcggtagcgggcagtaaacgtggtgcgcatctggcgttaagtctggagcggctc
gatgcgctgctccacacctcagcacagcgaattggcctttctgccactgtgcgctcagcc
agcgatgtggcagcatttcttggtggcgatcgcccggttacggtagtcaacccgcccgca
atgcgccatccgcagatacgaattgtcgtaccggtcgccaatatggatgatgtctcatcg
gtcgccagcggcaccggcgaagacagccatgccggccgggaaggctccatctggccatat
attgaaacgggtatccttgatgaagtgttgcgccatcgctcgaccattgtctttactaat
tcgcgggggctggcggaaaaactgacggcacgattaaatgagctttacgccgcacgctta
cagcgttccccgtctatcgccgttgatgcggcccatttcgagtcgacctccggcgcaacc
tctaaccgtgtacaaagtagcgacgtttttattgcccgctcacaccacggctccgtctct
aaagaacaacgagcaatcaccgaacaggcgctgaaatcgggtgaattacgctgcgtggtc
gcaacctccagtcttgaactggggattgatatgggcgcggtggatctggtgattcaggtg
gcaacgccgctttctgttgccagtgggttacaacgcattggtcgcgccggacatcaggtt
ggcggtgtatctaaagggctgtttttcccccgtacccggcgtgatttagtcgattccgca
gtcattgtagagtgtatgttcgcaggcaggctggaaaacctgacaccaccgcataatcct
ctcgacgtccttgcgcagcaaaccgttgccgccgcggcgatggatgcattacaggtagac
gaatggtactcccgcgtacgccgtgccgcaccgtggaaagatctgccaagacgtgttttt
gacgccacgctggatatgctttccgggcgctatccctctggcgatttttctgcttttcgc
cccaaactggtctggaacagggagaccgggatattgaccgcccgacctggcgctcaattg
ttggcggttaccagcggcggcaccattccggatcgtggcatgtatagcgtgttattaccc
gaaggtgaagaaaaggccggttcgcggcgggtgggtgaactggatgaggagatggtatat
gagtcgcgggtgaacgacattatcactctcggcgctacctcatggcggatccagcaaatc
acccgcgatcaggtgattgtgactcctgctccgggtcgttctgcccggctccccttctgg
cgtggtgaaggtaacggacgtccggctgaattaggcgagatgatcggcgattttcttcat
ttgctggcggatggcgcgttcttttccgggactattcccccgtggctggcagaagaaaat
acgatcgccaatattcaggggttgattgaggagcagcgcaacgcgacgggcatcgttccg
gggagtcgccatctggtcctcgaacggtgccgtgatgaaattggtgactggcgtattatt
ttgcactctccctatggaagacgggtgcatgaaccctgggcggtggcgattgccgggcga
atacatgcgctatggggcgctgacgcgtcggtggtcgccagtgatgacggcattgttgca
cgtattcctgacaccgatggtaaattgcccgatgccgcgatttttttgtttgaaccagaa
aagttgctgcaaattgtccgcgaggcggtaggcagctcggcacttttcgccgcccgtttt
cgcgaatgcgccgcgcgggcattattaatgccggggcgcactccgggccatcgcaccccg
ctttggcaacaacggctgcgcgccagtcagttgctggaaatcgctcagggatatccggat
tttccggtcattctcgaaaccctacgcgaatgtctgcaagatgtttatgatcttcccgca
ctggaacgtttgatgcgtcgcctgaacggtggcgaaattcaaatatccgatgtaacgacc
actacgccctcgcctttcgccacaagtttattgttcggctatgtcgcggaatttatgtac
cagagcgacgccccgctggcagagcgccgggcatccgtactgtcgctggacagcgagtta
ctgcgcaatctactcggacaggtcgatccgggggaattactcgacccgcaggtcattcgc
caggtggaagaagagttgcaacgactggctcctggcagaagagcgaaaggtgaagaagga
ttgttcgacctgctgcgcgaactggggccaatgaccgttgaagacctggcgcaacggcat
acaggcagcagtgaagaggttgcgtcgtatctggaaaatcttcttgcagtaaaacgaatc
ttcccagcgatgattagcggacaggagcgtcttgcctgtatggatgatgccgccaggctg
cgtgatgccctcggcgtacgactaccagagtcattgccagagatttatttacatagagtc
agttacccgcttcgcgacctctttctgcgctatctccgggctcatgctctggtcacggct
gaacaactggctcatgagtttagtctcggtattgccattgtcgaagagcagcttcagcaa
ctgcgtgaacagggtctggtgatgaatctgcaacaagacatctgggtgagcgatgaagta
tttcgtcgtctgcgtttgcgctcgctgcaagccgccagagaagcgacgcgtcccgttgca
gccacgacctatgcgcgattgctgctggaacgtcagggcgtattacccgccaccgatggt
agcccggcgctctttgcctcaacatcgccaggcgtttatgagggcgtagatggcgtgatg
cgggtgatcgaacagcttgccggagtcggtttacccgcctcactctgggaaagccagatc
ctgcctgcccgcgtacgcgactattcgtcagaaatgctcgatgaattactggcaaccggt
gcggttatctggtcggggcaaaaaaaactgggtgaagatgacggcctggtggcactgcat
ctacaggaatatgctgcagaatcgttcactcccgccgaagcggatcaggcgaatcgttcg
gcgctgcaacaagcgatagtcgctgttctggctgacggaggagcctggtttgcacaacaa
atcagccaacggatacgcgacaaaatcggcgaatcggttgatctctctgccctgcaagag
gcgttatgggcgctggtctggcaaggcgtcatcaccagcgacatttgggcaccgttacgc
gccctcacccgcagcagttccaacgcacgcacctcaactcgccgcagtcaccgggctcgt
cgtggacgtcctgtctatgcgcaacccgtctcgccgcgggtatcttacaacacaccaaat
ctggctggacgctggtcgttattgcaggtggagccactaaacgataccgaaaggatgctg
gcgctggcggaaaatatgctcgaccgctacggcatcatcagtcgtcaggcggtgatagcc
gaaaatatccctggcgggtttccatcgatgcaaacgctttgtcgaagtatggaagactcc
gggcgaattatgcgaggtcgttttgtagaaggtctgggtggcgcgcaattcgctgaacgt
ctgactattgaccgattgcgcgatctggcgacacaagccacgcaaacgcgccactataca
ccagtggcgctctctgccaacgatccggctaatgtgtggggaaatcttctgccctggcct
gcacatccggcaacgctggttccaacgcgtcgggcgggtgcgctggtggtcgtttctggc
ggcaaattgttactctatctggcgcaaggtggcaaaaaaatgctggtctggcaggaaaaa
gaggaattactcgccccagaggttttccacgcgctgactaccgcactgcgtcgcgaacca
cggctgcgctttacgctaacagaagtgaatgatctaccggtccggcaaacgccgatgttt
acgctgctgcgtgaggcgggattttcaagttcgccacaagggctggattggggatag

DBGET integrated database retrieval system