KEGG   Escherichia coli K-12 MG1655: b1657Help
Entry
b1657             CDS       T00007                                 

Gene name
ydhP
Definition
(RefSeq) putative MFS transporter, inner membrane protein
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    b1657 (ydhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_4 Sugar_tr DUF1186
Motif
Other DBs
NCBI-GeneID: 947340
NCBI-ProteinID: NP_416174
Pasteur: ydhP
RegulonDB: ECK120003482
ECOCYC: G6893
ASAP: ABE-0005540
UniProt: P77389
Position
complement(1736121..1737290)
Genome map
AA seq 389 aa AA seqDB search
MKINYPLLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGMLISAYAVGVMVGAPLM
TLLLSHRARRSALIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAAS
VVPKHKQASAVATMFMGLTLANIGGVPAATWLGETIGWRMSFLATAGLGVISMVSLFFSL
PKGGAGARPEVKKELAVLMRPQVLSALLTTVLGAGAMFTLYTYISPVLQSITHATPVFVT
AMLVLIGVGFSIGNYLGGKLADRSVNGTLKGFLLLLMVIMLAIPFLARNEFGAAISMVVW
GAATFAVVPPLQMRVMRVASEAPGLSSSVNIGAFNLGNALGAAAGGAVISAGLGYSFVPV
MGAIVAGLALLLVFMSARKQPETVCVANS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaactatccgttgctggcgctggcgattggcgcgtttggtatcgggacaacg
gagttctcgccaatgggcttgttgcccgtcattgcgcgcggtgtggatgtctcgattccc
gctgccggaatgttaatcagtgcctatgcagttggcgtaatggttggcgcgccgctgatg
acgcttctactttctcatcgtgcccgccgcagtgcgttgattttcctgatggcaattttc
acgctcggcaacgtactttccgccatcgcgccggattatatgaccctgatgctttcacgc
attttgaccagcctgaatcacggagcattttttggtttgggttcagtcgtggccgcaagc
gtggtgccaaaacataaacaggccagcgcagttgccactatgtttatggggttaaccctg
gcaaatatcggtggcgtgccggcggcgacctggttgggtgaaaccatcggctggcggatg
tcatttctggcaacggcggggctgggagtgatttcaatggtaagtctgttcttctcatta
cctaaaggtggtgcaggggcacgacctgaagtgaaaaaagagctggcggtattaatgcgt
ccgcaggtgctgtctgcattgctgacgacggtactgggagctggtgcaatgtttactctc
tacacctatatctctccggtactgcaaagtattacccacgcaacaccggtgttcgtcacg
gcaatgctggtgctgattggtgtcggattctctatcggtaactatctcggcggcaaactg
gcagatcgttcagttaacggcacgttgaaaggctttttgttgttgttgatggtgattatg
ctggcaatcccgttcctggcccgcaatgagttcggcgcagctattagcatggtggtgtgg
ggcgcagcaacctttgcggtcgtaccgccgttacagatgcgcgtgatgcgtgtcgccagt
gaagcgccaggtctgtcttcatcagtcaatattggtgcctttaatcttggaaatgcgctg
ggagcagctgctggtggtgcggtaatttccgctgggctgggatacagctttgtgccggtg
atgggagcgattgtcgcgggactggcattattgctggtgtttatgtcagccagaaaacaa
cctgaaacagtttgcgttgctaacagctaa

DBGET integrated database retrieval system