KEGG   Escherichia coli K-12 MG1655: b1658Help
Entry
b1658             CDS       T00007                                 

Gene name
purR
Definition
(RefSeq) transcriptional repressor, hypoxanthine-binding
  KO
K03604  
LacI family transcriptional regulator, purine nucleotide synthesis repressor
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    b1658 (purR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1737844..1738869
Genome map
AA seq 341 aa AA seqDB search
MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTK
SIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLL
VMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHRE
IGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRP
TAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGET
AFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaataaaagatgtagcgaaacgagcaaacgtttccactacaactgtgtcacac
gtgatcaacaaaacacgtttcgtcgctgaagaaacgcgcaacgccgtgtgggcagcgatt
aaagaattacactactcccctagcgcggtggcgcgtagcctgaaggttaaccacaccaag
tctatcggtttgctggcgaccagcagcgaagcggcctattttgccgagatcattgaagca
gttgaaaaaaattgcttccagaaaggttacaccctgattctgggcaatgcgtggaacaat
cttgagaaacagcgggcttatctgtcgatgatggcgcaaaaacgcgtcgatggtctgctg
gtgatgtgttctgagtacccagagccgttgctggcgatgctggaagagtatcgccatatc
ccaatggtggtcatggactggggtgaagcaaaagctgacttcaccgatgcggtcattgat
aacgcgttcgaaggcggctacatggccgggcgttatctgattgaacgcggtcaccgcgaa
atcggcgtcatccccggcccgctggaacgtaacaccggcgcaggccgccttgccggtttt
atgaaggcgatggaagaagcgatgatcaaggtgccggaaagctggattgtgcagggtgac
tttgaacctgaatccggttatcgcgccatgcagcaaatcctgtcgcagccgcatcgccct
actgccgtcttctgtggtggcgatatcatggcaatgggcgcactttgtgctgctgatgaa
atgggcctgcgcgtcccgcaggatgtttcgctgatcggttatgataacgtgcgcaacgcg
cgctattttacgccggcgctgaccacgatccatcagccaaaagattcgctgggtgaaaca
gcgttcaacatgctgttggatcgtatcgtcaacaaacgtgaagaaccgcagtctattgaa
gtgcatccgcgcttgattgaacgccgctccgtggctgacggcccgttccgcgactatcgt
cgttaa

DBGET integrated database retrieval system