KEGG   Escherichia coli K-12 MG1655: b1663Help
Entry
b1663             CDS       T00007                                 

Gene name
mdtK
Definition
(RefSeq) multidrug efflux system transporter
  KO
K03327  
multidrug resistance protein, MATE family
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Solute Carrier Family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   b1663 (mdtK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1743457..1744830
Genome map
AA seq 457 aa AA seqDB search
MQKYISEARLLLALAIPVILAQIAQTAMGFVDTVMAGGYSATDMAAVAIGTSIWLPAILF
GHGLLLALTPVIAQLNGSGRRERIAHQVRQGFWLAGFVSVLIMLVLWNAGYIIRSMENID
PALADKAVGYLRALLWGAPGYLFFQVARNQCEGLAKTKPGMVMGFIGLLVNIPVNYIFIY
GHFGMPELGGVGCGVATAAVYWVMFLAMVSYIKRARSMRDIRNEKGTAKPDPAVMKRLIQ
LGLPIALALFFEVTLFAVVALLVSPLGIVDVAGHQIALNFSSLMFVLPMSLAAAVTIRVG
YRLGQGSTLDAQTAARTGLMVGVCMATLTAIFTVSLREQIALLYNDNPEVVTLAAHLMLL
AAVYQISDSIQVIGSGILRGYKDTRSIFYITFTAYWVLGLPSGYILALTDLVVEPMGPAG
FWIGFIIGLTSAAIMMMLRMRFLQRLPSAIILQRASR
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagtatatcagtgaagcgcgtctgttattagcattagcaatcccggtgattctc
gcgcaaatcgcccaaactgcgatgggttttgtcgataccgtgatggcgggcggctatagt
gccaccgacatggcggcggtcgctatcggtacttctatctggcttccggcgatcctcttt
ggtcacggactgctgctggcattaacgccggttatcgcgcaattaaatggttccggtcga
cgtgagcgcattgcgcatcaggtgcgacaaggtttctggctggcaggttttgtttccgtt
ctcattatgctggtgctgtggaatgcaggttacattatccgctccatggaaaacatcgat
ccggctctggcggacaaagccgtgggttatctgcgtgcgttgttgtggggcgcgccggga
tatctgttcttccaggttgcccgtaaccagtgtgaaggtctggcaaaaaccaagccgggt
atggtaatgggctttatcggcctgctggtgaacatcccggtgaactatatctttatttat
ggtcatttcggtatgcctgagctcggtggcgttggttgtggcgtggctactgcggcggtg
tattgggtcatgttccttgccatggtttcttacattaaacgcgcccgctccatgcgcgat
attcgtaacgaaaaaggcaccgcaaaacccgatcctgcggttatgaaacgactgattcaa
ctcggtttgccgattgcgctggcactgttctttgaagtgacactgtttgccgtcgtggct
ctgttagtgtctccgctcggtattgttgatgtcgcaggacaccagattgccctgaacttt
agttcactaatgttcgtgcttccaatgtcgctggcggcagcggtaactatccgcgtaggt
tatcgtctgggtcagggctcaacgctggatgcgcaaaccgctgcgcggaccgggcttatg
gtgggtgtctgtatggcaaccctgacggccattttcacggtttcactgcgggagcaaatc
gccctgttgtacaacgacaatcccgaggttgtaacgctggctgcgcatttgatgttgctg
gcggcggtatatcagatttctgactcaatccaggtgattggcagtgggattttgcgtggt
tataaagatacgcgttccattttctatattacctttacggcttactgggtgctgggcttg
ccaagcggctatattctggcactgaccgatctggtcgttgaacctatggggccagcaggc
ttctggataggctttattattggcctgacgtcggcagccattatgatgatgttgcgtatg
cggttcctgcaacgtctgccgtcagccatcattctgcaacgagcatcccgctaa

DBGET integrated database retrieval system