KEGG   Escherichia coli K-12 MG1655: b1667Help
Entry
b1667             CDS       T00007                                 

Gene name
ydhR
Definition
(RefSeq) putative monooxygenase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1746700..1747005
Genome map
AA seq 101 aa AA seqDB search
MATLLQLHFAFNGPFGDAMAEQLKPLAESINQEPGFLWKVWTESEKNHEAGGIYLFTDEK
SALAYLEKHTARLKNLGVEEVVAKVFDVNEPLSQINQAKLA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttgttacaacttcattttgcttttaatggcccatttggcgacgcaatggct
gagcagcttaaaccacttgctgagtcgattaatcaggaacctggttttctgtggaaggta
tggacagaaagtgaaaagaaccacgaagccggtgggatctaccttttcactgatgaaaaa
agcgcccttgcctatctggaaaaacatactgcccgactgaaaaatctcggcgttgaggaa
gttgtcgccaaagttttcgatgtcaatgagccacttagtcaaatcaatcaggcaaaactc
gcctga

DBGET integrated database retrieval system