KEGG   Escherichia coli K-12 MG1655: b1676Help
Entry
b1676             CDS       T00007                                 

Gene name
pykF
Definition
(RefSeq) pyruvate kinase I
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00230  Purine metabolism
eco00620  Pyruvate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eco_M00002  Glycolysis, core module involving three-carbon compounds
eco_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
eco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b1676 (pykF)
   00620 Pyruvate metabolism
    b1676 (pykF)
  Nucleotide metabolism
   00230 Purine metabolism
    b1676 (pykF)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     b1676 (pykF)
Membrane trafficking [BR:eco04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    b1676 (pykF)
Exosome [BR:eco04147]
 Exosomal proteins
  Proteins found in most exosomes
   b1676 (pykF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI DUF4115 DUF4651
Motif
Other DBs
NCBI-GeneID: 946179
NCBI-ProteinID: NP_416191
Pasteur: pykF
RegulonDB: ECK120000795
ECOCYC: EG10804
ASAP: ABE-0005600
UniProt: P0AD61
Structure
PDB: 

Jmol
Position
1755698..1757110
Genome map
AA seq 470 aa AA seqDB search
MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKT
AAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVG
NTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIF
GCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGI
MVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVAN
AILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEFNNDNRKLRITEAVCR
GAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLV
KEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccaaaattgtttgcaccatcggaccgaaaaccgaatctgaagagatgtta
gctaaaatgctggacgctggcatgaacgttatgcgtctgaacttctctcatggtgactat
gcagaacacggtcagcgcattcagaatctgcgcaacgtgatgagcaaaactggtaaaacc
gccgctatcctgcttgataccaaaggtccggaaatccgcaccatgaaactggaaggcggt
aacgacgtttctctgaaagctggtcagacctttactttcaccactgataaatctgttatc
ggcaacagcgaaatggttgcggtaacgtatgaaggtttcactactgacctgtctgttggc
aacaccgtactggttgacgatggtctgatcggtatggaagttaccgccattgaaggtaac
aaagttatctgtaaagtgctgaacaacggtgacctgggcgaaaacaaaggtgtgaacctg
cctggcgtttccattgctctgccagcactggctgaaaaagacaaacaggacctgatcttt
ggttgcgaacaaggcgtagactttgttgctgcttcctttattcgtaagcgttctgacgtt
atcgaaatccgtgagcacctgaaagcgcacggcggcgaaaacatccacatcatctccaaa
atcgaaaaccaggaaggcctcaacaacttcgacgaaatcctcgaagcctctgacggcatc
atggttgcgcgtggcgacctgggtgtagaaatcccggtagaagaagttatcttcgcccag
aagatgatgatcgaaaaatgtatccgtgcacgtaaagtcgttatcactgcgacccagatg
ctggattccatgatcaaaaacccacgcccgactcgcgcagaagccggtgacgttgcaaac
gccatcctcgacggtactgacgcagtgatgctgtctggtgaatccgcaaaaggtaaatac
ccgctggaagcggtttctatcatggcgaccatctgcgaacgtaccgaccgcgtgatgaac
agccgtctcgagttcaacaatgacaaccgtaaactgcgcattaccgaagcggtatgccgt
ggtgccgttgaaactgctgaaaaactggatgctccgctgatcgtggttgctactcagggc
ggtaaatctgctcgcgcagtacgtaaatacttcccggatgccaccatcctggcactgacc
accaacgaaaaaacggctcatcagttggtactgagcaaaggcgttgtgccgcagcttgtt
aaagagatcacttctactgatgatttctaccgtctgggtaaagaactggctctgcagagc
ggtctggcacacaaaggtgacgttgtagttatggtttctggtgcactggtaccgagcggc
actactaacaccgcatctgttcacgtcctgtaa

DBGET integrated database retrieval system