KEGG   Escherichia coli K-12 MG1655: b1684Help
Entry
b1684             CDS       T00007                                 

Gene name
sufA
Definition
(RefSeq) Fe-S cluster assembly protein
  KO
K05997  
Fe-S cluster assembly protein SufA
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1764018..1764386)
Genome map
AA seq 122 aa AA seqDB search
MDMHSGTFNPQDFAWQGLTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSV
SEPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESF
GV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggacatgcattcaggaacctttaacccacaagatttcgcctggcaaggcttaacgctg
acacccgcagcggcgatacacatccgtgagctggtggcaaagcagccgggtatggtcggc
gtgcgcttaggcgtgaagcaaacgggctgcgcgggctttggctatgtgctcgacagtgtt
agcgagccggacaaagacgatctgctgtttgaacacgacggcgcgaagctgtttgtcccg
ctgcaagcgatgccgtttattgatggcacggaagtcgatttcgttcgtgaaggacttaat
cagatattcaaatttcacaaccctaaagcccagaatgaatgtggctgtggcgaaagcttt
ggggtatag

DBGET integrated database retrieval system