KEGG   Escherichia coli K-12 MG1655: b1688Help
Entry
b1688             CDS       T00007                                 

Gene name
ydiK
Definition
(RefSeq) UPF0118 family inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1769074..1770186
Genome map
AA seq 370 aa AA seqDB search
MVNVRQPRDVAQILLSVLFLAIMIVACLWIVQPFILGFAWAGTVVIATWPVLLRLQKIMF
GRRSLAVLVMTLLLVMVFIIPIALLVNSIVDGSGPLIKAISSGDMTLPDLAWLNTIPVIG
AKLYAGWHNLLDMGGTAIMAKVRPYIGTTTTWFVGQAAHIGRFMVHCALMLLFSALLYWR
GEQVAQGIRHFATRLAGVRGDAAVLLAAQAIRAVALGVVVTALVQAVLGGIGLAVSGVPY
ATLLTVLMILSCLVQLGPLPVLIPAIIWLYWTGDTTWGTVLLVWSGVVGTLDNVIRPMLI
RMGADLPLILILSGVIGGLIAFGMIGLFIGPVLLAVSWRLFAAWVEEVPPPTDQPEEILE
ELGEIEKPNK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatgttcgtcagcccagggatgtcgcacaaattctgctttcggtgctgttttta
gccatcatgattgtggcatgtctgtggattgttcaaccctttattctcggctttgcatgg
gccggtacggtggttatcgccacctggccggtattgttacgtttgcaaaagatcatgttt
ggccgccgctctctcgccgttctggtgatgacgctgttattagtgatggtgtttatcatc
cctattgctttgctggttaacagtatcgtcgacggcagcggcccgctaattaaagccatt
tccagcggtgacatgacgttacccgatctggcgtggcttaataccattccggtgattggc
gcgaagctgtatgcaggctggcacaacttgctggatatgggggggacggcgatcatggcg
aaagtccgcccttatattggcaccaccaccacctggttcgttgggcaggcggcgcatatc
gggcgctttatggtgcattgtgcgctgatgcttctcttcagtgccctgctgtactggcgc
ggtgaacaggtggcacaaggcattcgccattttgcaacccgtctggcaggcgttcgcgga
gatgccgccgtgctgctggcggcacaggctatccgcgcggtggcgctgggtgtggtggtg
acggcgttagtacaggcagtgcttggcggtatcggcctcgccgtatccggcgtaccttat
gcaacgttgctaacggtgttaatgatcctctcctgccttgtccagcttggcccgttgccg
gtactgattccggcgattatctggctctactggactggcgataccacctggggaacggta
ttgttagtgtggagcggtgtggttggcacgctggataacgtcatccgcccaatgttaatt
cgcatgggtgccgatttaccgctgatcctgattctctctggcgttattggtggtttgatt
gctttcgggatgatcggtctgtttattggtccggttctgttagccgtttcctggcgtctg
tttgccgcgtgggtggaagaagtcccgccgccgacggaccaaccggaagaaattctcgaa
gaacttggcgaaatcgagaaaccgaataagtaa

DBGET integrated database retrieval system