KEGG   Escherichia coli K-12 MG1655: b1690Help
Entry
b1690             CDS       T00007                                 

Gene name
ydiM
Definition
(RefSeq) MFS superfamily sugar transport 1 family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1771071..1772285
Genome map
AA seq 404 aa AA seqDB search
MKNPYFPTALGLYFNYLVHGMGVLLMSLNMASLETLWQTNAAGVSIVISSLGIGRLSVLL
FAGLLSDRFGRRPFIMLGMCCYMAFFFGILQTNNIIIAYVFGFLAGMANSFLDAGTYPSL
MEAFPRSPGTANILIKAFVSSGQFLLPLIISLLVWAELWFGWSFMIAAGIMFINALFLYR
CTFPPHPGRRLPVIKKTTSSTEHRCSIIDLASYTLYGYISMATFYLVSQWLAQYGQFVAG
MSYTMSIKLLSIYTVGSLLCVFITAPLIRNTVRPTTLLMLYTFISFIALFTVCLHPTFYV
VIIFAFVIGFTSAGGVVQIGLTLMAERFPYAKGKATGIYYSAGSIATFTIPLITAHLSQR
SIADIMWFDTAIAAIGFLLALFIGLRSRKKTRHHSLKENVAPGG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatccctatttccctaccgcacttgggttgtattttaattacctggtgcatggt
atgggcgtccttttgatgagcctgaatatggcctcgctggagacactttggcagactaat
gccgcgggtgtctcgatagttatctcatcgctgggcattggtcgattaagtgtcttgctt
tttgcaggattattatccgatcgctttggtcgccgcccttttatcatgctcgggatgtgc
tgctatatggccttcttttttggcatcctgcagaccaataacatcattatcgcttatgtt
tttggctttctggcgggaatggcaaacagttttctcgatgcaggcacttatcccagtttg
atggaagcttttccacgctcacctgggacagccaatattttaattaaagcatttgtttcc
agcggacaatttttattaccgctaatcattagcctgttagtgtgggctgaactgtggttc
ggttggtcctttatgattgctgcaggcattatgtttattaacgctctgtttttataccgt
tgtacgttcccaccccatccgggtcgtcgcttacctgtcataaagaaaaccaccagctct
acggaacatcgctgttcaattatcgatttagccagttataccttatatggctatatctca
atggcaacgttttatctggttagccagtggctggcacagtacggacaatttgttgcaggc
atgtcatacactatgtcgatcaaactactcagtatctacaccgtgggttcgctgctttgt
gtatttattaccgctccactcattcgtaataccgttcgcccaacaacattactgatgctg
tacacctttatctcatttattgctctgtttaccgtctgcctgcatcccacattttatgtg
gtgataatatttgcttttgtcattggttttacctctgctggaggtgttgtgcaaattggc
ctgacgttaatggctgaacgtttcccttacgctaaaggtaaagctacagggatctattac
agtgcgggcagtattgcgacctttactattccgttgattacggctcatctgtcccaaaga
agtattgccgatattatgtggttcgataccgccatcgctgccatcggttttttactggca
ctgtttatcggcttacgcagccgcaaaaaaacgcggcatcactcgctaaaggaaaatgtc
gctccgggtgggtaa

DBGET integrated database retrieval system