KEGG   Escherichia coli K-12 MG1655: b1700Help
Entry
b1700             CDS       T00007                                 

Gene name
ydiT
Definition
(RefSeq) putative 3Fe-4S ferredoxin-type protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1782681..1782974
Genome map
AA seq 97 aa AA seqDB search
MSQNATVNVDIKLGVNKFHVDEGHPHIILAENPDINEFHKLMKACPAGLYKQDDAGNIHF
DSAGCLECGTCRVLCGNTILEQWQYPAGTFGIDFRYG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaacgctacggttaacgtcgacatcaaattaggcgtcaataaattccatgtt
gatgagggccacccgcatatcattctggcggaaaatcccgatatcaatgaattccataaa
ttaatgaaagcctgccctgccggactttataagcaggatgacgcaggaaacattcatttt
gattccgccggttgtctggagtgcggcacctgtcgggtgctgtgcggtaacactattctc
gaacagtggcaatatcccgcaggcaccttcggtattgattttcgctacggctaa

DBGET integrated database retrieval system