KEGG   Escherichia coli K-12 MG1655: b1700Help
Entry
b1700             CDS       T00007                                 

Gene name
ydiT
Definition
(RefSeq) putative 3Fe-4S ferredoxin-type protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF_QO Fer4_9 Fer4_2 Fer4_10
Motif
Other DBs
NCBI-GeneID: 946214
NCBI-ProteinID: NP_416215
Pasteur: ydiT
RegulonDB: ECK120003511
ECOCYC: G6923
ASAP: ABE-0005674
UniProt: P77714
Position
1782681..1782974
Genome map
AA seq 97 aa AA seqDB search
MSQNATVNVDIKLGVNKFHVDEGHPHIILAENPDINEFHKLMKACPAGLYKQDDAGNIHF
DSAGCLECGTCRVLCGNTILEQWQYPAGTFGIDFRYG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaacgctacggttaacgtcgacatcaaattaggcgtcaataaattccatgtt
gatgagggccacccgcatatcattctggcggaaaatcccgatatcaatgaattccataaa
ttaatgaaagcctgccctgccggactttataagcaggatgacgcaggaaacattcatttt
gattccgccggttgtctggagtgcggcacctgtcgggtgctgtgcggtaacactattctc
gaacagtggcaatatcccgcaggcaccttcggtattgattttcgctacggctaa

DBGET integrated database retrieval system