KEGG   Escherichia coli K-12 MG1655: b1708Help
Entry
b1708             CDS       T00007                                 

Gene name
nlpC
Definition
(RefSeq) putative C40 clan peptidase lipoprotein
  KO
K13695  
probable lipoprotein NlpC
Organism
eco  Escherichia coli K-12 MG1655
Brite
Peptidases [BR:eco01002]
 Cysteine Peptidases
  Family C40
   b1708 (nlpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1792267..1792731)
Genome map
AA seq 154 aa AA seqDB search
MRFCLILITALLLAGCSHHKAPPPNARLSDSITVIAGLNDQLQSWHGTPYRYGGMTRRGV
DCSGFVVVTMRDRFDLQLPRETKQQASIGTQIDKDELLPGDLVFFKTGSGQNGLHVGIYD
TNNQFIHASTSKGVMRSSLDNVYWQKNFWQARRI
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctgccttattttgatcacagcactgcttctggccgggtgtagccaccataaa
gcaccgccgccaaatgccagactttctgattcgattaccgttattgccggtttgaacgac
cagctacaaagctggcatggcacgccgtatcgttatggtggcatgacgcggcgcggtgtg
gactgttcgggatttgtggttgtgacgatgcgcgatcgtttcgatttgcagctgccccgt
gaaaccaaacaacaagcctctattggcacgcaaattgataaagacgagttgctgccaggt
gacctggtctttttcaaaacggggtccggacaaaatggtttgcatgtaggtatttacgat
accaacaaccaatttatccacgcctctaccagcaagggagtgatgcgttcctcacttgat
aatgtctattggcagaaaaatttctggcaggcgagacgaatctag

DBGET integrated database retrieval system