KEGG   Escherichia coli K-12 MG1655: b1711Help
Entry
b1711             CDS       T00007                                 

Gene name
btuC
Definition
(RefSeq) vitamin B12 transporter subunit: membrane component of ABC superfamily
  KO
K06073  
vitamin B12 transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Vitamin B12 transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b1711 (btuC)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Vitamin B12 transporter [MD:M00241] [OT]
    b1711 (btuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1794172..1795152)
Genome map
AA seq 326 aa AA seqDB search
MLTLARQQQRQNIRWLLCLSVLMLLALLLSLCAGEQWISPGDWFTPRGELFVWQIRLPRT
LAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLC
AIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMM
GGFGGVDWRQSWLMLALIPVLLWICCQSRPMNMLALGEISARQLGLPLWFWRNVLVAATG
WMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLALAA
AELPIGVVTATLGAPVFIWLLLKAGR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgacacttgcccgccaacaacagcgacaaaatattcgctggttattatgcctgtca
gttttgatgctgctggcgcttctcttaagcctttgcgccggtgaacaatggatctcgcca
ggtgactggtttactcctcgtggcgaactgttcgtctggcaaattcgcctgccacgtacg
ctggctgtattgctggttggtgcggcgctggctatatccggcgctgtaatgcaggcgttg
tttgaaaatcctctggcagaacctggactacttggcgtctctaacggcgcaggcgtgggg
cttatcgccgcggtattgcttgggcaagggcaactccccaactgggcgctagggctgtgt
gcgattgctggcgcgcttatcatcactttaatactcttacgtttcgcccgtcgtcatctt
tcgaccagtcggttattgctggctggcgttgcattagggattatctgtagcgcactaatg
acgtgggctatctacttttccacctcagttgatttgcgtcagctgatgtactggatgatg
ggcggttttggcggcgtagactggcggcaaagctggctgatgctggcattgatccccgtg
ttgttgtggatctgttgtcagtccaggccgatgaatatgttagcacttggcgagatctcg
gcgcggcaactgggtttacccctgtggttctggcgcaatgtgctggtggcagcgaccggc
tggatggttggcgtcagtgtggcgctggcgggtgctatcggctttattggtctggtgatc
ccccatattctccggttgtgtggtttaaccgatcatcgcgtattacttcccggctgcgcg
ctggcaggggcgagcgcattgctgctggccgatattgtagcgcgcctggcattagctgcc
gcagagctgcctattggcgtggtcaccgcaacgttaggtgcgccggtgtttatctggtta
ttgttaaaagcaggacgttag

DBGET integrated database retrieval system