KEGG   Escherichia coli K-12 MG1655: b1712Help
Entry
b1712             CDS       T00007                                 

Gene name
ihfA
Definition
(RefSeq) integration host factor (IHF), DNA-binding protein, alpha subunit
  KO
K04764  
integration host factor subunit alpha
Organism
eco  Escherichia coli K-12 MG1655
Brite
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    b1712 (ihfA)
Chromosome [BR:eco03036]
 Prokaryotic Type
  Nucleoid associated proteins
   IHF (integration host factor)
    b1712 (ihfA)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Facilitator
      b1712 (ihfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1795253..1795552)
Genome map
AA seq 99 aa AA seqDB search
MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQR
PGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttacaaaagctgaaatgtcagaatatctgtttgataagcttgggcttagcaag
cgggatgccaaagaactggttgaactgtttttcgaagagatccgtcgcgctctggaaaac
ggcgaacaggtgaaactctctggttttggtaacttcgatctgcgtgataagaatcaacgc
ccgggacgtaacccgaaaacgggcgaggatattcccattacagcacggcgcgtggtgacc
ttcagacccgggcagaagttaaaaagccgggtcgaaaacgcttcgcccaaagacgagtaa

DBGET integrated database retrieval system