KEGG   Escherichia coli K-12 MG1655: b1724Help
Entry
b1724             CDS       T00007                                 

Gene name
ydiZ
Definition
(RefSeq) uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GhoS
Motif
Other DBs
NCBI-GeneID: 946232
NCBI-ProteinID: NP_416238
Pasteur: ydiZ
RegulonDB: ECK120003517
ECOCYC: G6929
ASAP: ABE-0005751
UniProt: P64479
Position
1807400..1807690
Genome map
AA seq 96 aa AA seqDB search
MASGDLVRYVITVMLHEDTLTEINELNNYLTRDGFLLTMTDDEGNIHELGTNTFGLISTQ
SEEEIRELVSGLTQSATGKDPEITITTWEEWNSNRK
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggccagtggcgatcttgtccgttatgtcataaccgtcatgttgcatgaggatacattg
actgaaattaacgagttgaataattacctgactcgcgacggttttttgctcactatgacg
gatgatgagggaaatatccatgagctgggaactaacacttttggacttatcagtacccaa
agtgaagaagaaattagagaactggtttcggggcttacccaaagtgcaaccggcaaagat
cctgaaatcaccatcacgacctgggaggaatggaatagcaacagaaaataa

DBGET integrated database retrieval system