KEGG   Escherichia coli K-12 MG1655: b1733Help
Entry
b1733             CDS       T00007                                 

Gene name
chbG
Definition
(RefSeq) chito-oligosaccharide deacetylase
  KO
K03478  
chitin disaccharide deacetylase [EC:3.5.1.105]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.105  chitin disaccharide deacetylase
     b1733 (chbG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1816386..1817135)
Genome map
AA seq 249 aa AA seqDB search
MERLLIVNADDFGLSKGQNYGIIEACRNGIVTSTTALVNGQAIDHAVQLSRDEPSLAIGM
HFVLTMGKPLTAMPGLTRDGVLGKWIWQLAEEDALPLEEITQELVSQYLRFIELFGRKPT
HLDSHHHVHMFPQIFPIVARFAAEQGIALRADRQMAFDLPVNLRTTQGFSSAFYGEEISE
SLFLQVLDDAGHRGDRSLEVMCHPAFIDNTIRQSAYCFPRLTELDVLTSASLKGAIAQRG
YRLGSYRDV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcttactgattgttaatgccgatgattttggcttaagcaaaggtcagaactac
ggcattatcgaggcctgtcgcaatgggattgtcacgtcgacgacggcgctggtgaatggg
caggctattgaccatgcggtgcagttgagtcgtgatgaaccgagtctggccatagggatg
cactttgtccttactatgggtaagccactgacagctatgccggggttaacccgcgatggt
gtgctgggaaaatggatctggcagttggcagaagaagatgctttaccgctggaagaaatt
actcaggagcttgtcagtcagtatttgcgtttcattgagctatttggacgcaaacctacg
catcttgatagccatcatcatgtgcatatgttcccgcagattttcccgattgttgccagg
tttgcggcagagcagggcattgcgttgcgggcggatcgtcagatggcgtttgatttgccg
gtcaacctgcgcactacccagggattcagcagtgcattctacggtgaagagatcagtgag
tcgctgttcctgcaagtgctggatgacgcaggccatcggggtgatcgttcgctggaggtg
atgtgtcatccggcgtttatcgataatactatccgtcagagtgcttactgtttcccacgc
ttaacggagctggatgtgttgacatcagcgtcgttgaaaggtgctatcgctcagcgtggt
tatcggttggggagttatcgggatgtgtaa

DBGET integrated database retrieval system