KEGG   Escherichia coli K-12 MG1655: b1755Help
Entry
b1755             CDS       T00007                                 

Gene name
ynjC
Definition
(RefSeq) inner membrane putative ABC superfamily transporter permease
  KO
K05778  
putative thiamine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Module
Putative thiamine transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative thiamine transporter [MD:M00192] [OT]
    b1755 (ynjC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1837212..1838747
Genome map
AA seq 511 aa AA seqDB search
MATPLRYALIFLLWAMVAVIYAPLIPAALTLISPALSLTHWQALFADPQLPQALLATLVS
TTIAAVGALLIALLVIVALWPGPKWQRMCARLPWLLAIPHVAFATSALLLFADGGLLYDY
FPYFTPPMDRFGIGLGLTLAVKESAFLLWILAAVLSEKWLLQQVIVLDSLGYSRWQCLNW
LLLPSVAPALAMAMLAIVAWSLSVVDVAIILGPGNPPTLAVISWQWLTQGDIDQQTKGAL
ASLLLMLLLAAYVLLSYLLWRSWRRTIPRVDGVRKPATPLLPGNTLAIFLPLTGVLCVVL
LAILADQSTINSEALINSLTMGLVATFIALLLLLLWLEWGPQRRQLWLWLPILLPALPLV
AGQYTLALWLKLDGSWTAVVWGHLLWVMPWMLFILQPAWQRIDSRLILIAQTLGWSRAKI
FFYVKCPLMLRPVLIAFAVGFAVGIAQYMPTLWLGAGRFPTLTTEAVALSSGGSNGILAA
QALWQLLLPLIIFALTALVAKWVGYVRQGLR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggctacaccgttacggtacgcattaatctttttgctgtgggcgatggtggcggtgatt
tatgcaccgctgatcccggcagctctcacgctgatatcgcctgctttgtcgttgacacac
tggcaggcgttatttgccgatccacagttaccgcaggcattactggcaacgctggtgtcg
acaaccatcgcggcggtcggggcattgttgattgccctgctggtgattgtggcgctgtgg
cctgggccgaaatggcagcgtatgtgcgcccgtctgccgtggctgctcgccattccccat
gtggcttttgccaccagcgcccttctgctctttgctgacggagggctgctttatgactat
ttcccgtatttcactccgccaatggaccgatttggcatcggtctgggcctcacccttgca
gtgaaagaaagcgcatttctgctgtggatcttagcagcagtattgagcgaaaaatggctg
ttgcagcaggtcattgtgctggattcgctgggctacagccgctggcaatgcctgaactgg
ctgctgttgccctccgtcgcgcctgcgctggcaatggcgatgctggcgattgttgcctgg
tcgctgtcggtcgtggatgtggcaattattctcgggccaggtaatcccccgacgctggcg
gtaattagctggcagtggttaacccagggcgacattgaccaacaaacaaaaggcgcgctt
gccagcctgctgttgatgctgttactcgccgcctacgttttgctgagctatctgctatgg
cgcagctggcggcgcactattccccgcgtagatggcgttcgcaagcctgccacgccttta
ttgccgggcaatacgctggcgatttttttacccttaaccggtgtgctgtgtgtggttctg
ctggcgatcctcgcggatcagtcgacgatcaatagtgaagcgctcatcaacagcctgaca
atggggctggtggcgacattcatcgctttgctcctgttactgctgtggctggaatggggg
ccacagcgtcgccagttgtggctatggttgcccattttattacctgctctgccactggtg
gcgggccagtacacgctggcgctatggctgaaactggatggaagctggacggcggtggtc
tgggggcatctgctgtgggtgatgccgtggatgctgtttatcctgcaacccgcctggcag
cgcattgattcacggttaattttgattgcgcaaacactgggctggtcgcgggccaaaatc
ttcttttacgtgaaatgcccactcatgttgcgccctgtgctgattgccttcgcggtggga
tttgcagtcggtattgcgcagtatatgccaacgctgtggctgggcgcggggcgttttccg
acgctcaccactgaggcggtggcattaagcagcggcggcagcaacggtattctcgccgcc
caggctttatggcaactgctattaccgcttattatttttgccctgaccgcgttagtcgca
aaatgggtaggttatgtcagacaaggactccgctaa

DBGET integrated database retrieval system