KEGG   Escherichia coli K-12 MG1655: b1755Help
Entry
b1755             CDS       T00007                                 

Gene name
ynjC
Definition
(RefSeq) putative ABC transporter permease
  KO
K05778  putative thiamine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Module
eco_M00192  Putative thiamine transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative thiamine transporter [MD:M00192] [OT]
    b1755 (ynjC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 946273
NCBI-ProteinID: NP_416269
Pasteur: ynjC
RegulonDB: ECK120003538
ECOCYC: G6950
ASAP: ABE-0005843
UniProt: P76224
Position
1837212..1838747
Genome map
AA seq 511 aa AA seqDB search
MATPLRYALIFLLWAMVAVIYAPLIPAALTLISPALSLTHWQALFADPQLPQALLATLVS
TTIAAVGALLIALLVIVALWPGPKWQRMCARLPWLLAIPHVAFATSALLLFADGGLLYDY
FPYFTPPMDRFGIGLGLTLAVKESAFLLWILAAVLSEKWLLQQVIVLDSLGYSRWQCLNW
LLLPSVAPALAMAMLAIVAWSLSVVDVAIILGPGNPPTLAVISWQWLTQGDIDQQTKGAL
ASLLLMLLLAAYVLLSYLLWRSWRRTIPRVDGVRKPATPLLPGNTLAIFLPLTGVLCVVL
LAILADQSTINSEALINSLTMGLVATFIALLLLLLWLEWGPQRRQLWLWLPILLPALPLV
AGQYTLALWLKLDGSWTAVVWGHLLWVMPWMLFILQPAWQRIDSRLILIAQTLGWSRAKI
FFYVKCPLMLRPVLIAFAVGFAVGIAQYMPTLWLGAGRFPTLTTEAVALSSGGSNGILAA
QALWQLLLPLIIFALTALVAKWVGYVRQGLR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggctacaccgttacggtacgcattaatctttttgctgtgggcgatggtggcggtgatt
tatgcaccgctgatcccggcagctctcacgctgatatcgcctgctttgtcgttgacacac
tggcaggcgttatttgccgatccacagttaccgcaggcattactggcaacgctggtgtcg
acaaccatcgcggcggtcggggcattgttgattgccctgctggtgattgtggcgctgtgg
cctgggccgaaatggcagcgtatgtgcgcccgtctgccgtggctgctcgccattccccat
gtggcttttgccaccagcgcccttctgctctttgctgacggagggctgctttatgactat
ttcccgtatttcactccgccaatggaccgatttggcatcggtctgggcctcacccttgca
gtgaaagaaagcgcatttctgctgtggatcttagcagcagtattgagcgaaaaatggctg
ttgcagcaggtcattgtgctggattcgctgggctacagccgctggcaatgcctgaactgg
ctgctgttgccctccgtcgcgcctgcgctggcaatggcgatgctggcgattgttgcctgg
tcgctgtcggtcgtggatgtggcaattattctcgggccaggtaatcccccgacgctggcg
gtaattagctggcagtggttaacccagggcgacattgaccaacaaacaaaaggcgcgctt
gccagcctgctgttgatgctgttactcgccgcctacgttttgctgagctatctgctatgg
cgcagctggcggcgcactattccccgcgtagatggcgttcgcaagcctgccacgccttta
ttgccgggcaatacgctggcgatttttttacccttaaccggtgtgctgtgtgtggttctg
ctggcgatcctcgcggatcagtcgacgatcaatagtgaagcgctcatcaacagcctgaca
atggggctggtggcgacattcatcgctttgctcctgttactgctgtggctggaatggggg
ccacagcgtcgccagttgtggctatggttgcccattttattacctgctctgccactggtg
gcgggccagtacacgctggcgctatggctgaaactggatggaagctggacggcggtggtc
tgggggcatctgctgtgggtgatgccgtggatgctgtttatcctgcaacccgcctggcag
cgcattgattcacggttaattttgattgcgcaaacactgggctggtcgcgggccaaaatc
ttcttttacgtgaaatgcccactcatgttgcgccctgtgctgattgccttcgcggtggga
tttgcagtcggtattgcgcagtatatgccaacgctgtggctgggcgcggggcgttttccg
acgctcaccactgaggcggtggcattaagcagcggcggcagcaacggtattctcgccgcc
caggctttatggcaactgctattaccgcttattatttttgccctgaccgcgttagtcgca
aaatgggtaggttatgtcagacaaggactccgctaa

DBGET integrated database retrieval system