KEGG   Escherichia coli K-12 MG1655: b1769Help
Entry
b1769             CDS       T00007                                 

Gene name
ydjE
Definition
(RefSeq) putative MFS sugar transporter, membrane protein
  KO
K08369  MFS transporter, putative metabolite:H+ symporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Others
    b1769 (ydjE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 946274
NCBI-ProteinID: NP_416283
Pasteur: ydjE
RegulonDB: ECK120002237
ECOCYC: EG12369
ASAP: ABE-0005894
UniProt: P38055
Position
complement(1852621..1853979)
Genome map
AA seq 452 aa AA seqDB search
MEQYDQIGARLDRLPLARFHYRIFGIISFSLLLTGFLSYSGNVVLAKLVSNGWSNNFLNA
AFTSALMFGYFIGSLTGGFIGDYFGRRRAFRINLLIVGIAATGAAFVPDMYWLIFFRFLM
GTGMGALIMVGYASFTEFIPATVRGKWSARLSFVGNWSPMLSAAIGVVVIAFFSWRIMFL
LGGIGILLAWFLSGKYFIESPRWLAGKGQIAGAECQLREVEQQIEREKSIRLPPLTSYQS
NSKVKVIKGTFWLLFKGEMLRRTLVAITVLIAMNISLYTITVWIPTIFVNSGIDVDKSIL
MTAVIMIGAPVGIFIAALIIDHFPRRLFGSTLLIIIAVLGYIYSIQTTEWAILIYGLVMI
FFLYMYVCFASAVYIPELWPTHLRLRGSGFVNAVGRIVAVFTPYGVAALLTHYGSITVFM
VLGVMLLLCALVLSIFGIETRKVSLEEISEVN
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatatgatcaaattggcgcaagactggaccgcttgcctttggcccggtttcat
tatcgtatatttggtattataagctttagtctgttattaacagggtttttgagttactcc
ggtaatgtcgtcttagcaaagctggtaagcaatggatggtcaaataatttcctcaatgcc
gcctttacctcggcattaatgtttggttatttcatcggctcacttactggtgggtttatt
ggtgactactttgggcggcgcagggcgtttcgcataaatcttctcatcgtcggtattgct
gcaacaggggccgcttttgtccctgatatgtactggctcatcttctttcgcttcctgatg
ggaacaggaatgggggcgctgattatggttggctatgcctcatttacggagtttatcccc
gcgacggtgcgtggaaaatggtccgcgcggctctcatttgttggtaactggtcgcccatg
ctgtctgcggcgataggcgtggtggttatcgctttttttagttggcgaataatgtttctg
ctgggtggtattggcatactgttagcctggtttctctcaggtaaatactttatcgagtcg
ccacgatggctggcagggaaagggcaaatcgcaggtgcagaatgccaacttcgtgaagta
gagcagcaaattgaaagagagaagagtattcgtttacccccgcttacttcgtatcagagc
aacagcaaggttaaagtaatcaagggtactttctggctcctgtttaaaggtgaaatgtta
cgacgtacattagtcgcgattactgttttaattgcaatgaacatttcgctttataccatc
accgtatggataccgaccatatttgttaactccggcattgatgtcgataaatcaatatta
atgaccgctgttattatgattggcgctccggtaggaatatttattgcggcattaattatt
gatcattttcctcgtcggttatttggctccaccttacttattattattgccgtgttaggc
tatatctattcaattcagactacagagtgggcgattttaatctatggactggtgatgatc
ttctttttatacatgtatgtttgcttcgcgtcggcggtttatatcccggagctttggcca
acgcatttacgcctgcgcggttcgggtttcgttaatgccgtcggacggatcgtcgcagtc
ttcacgccctatggcgttgcggcattattaacacattatgggtcgatcacggtgtttatg
gtacttggtgttatgttattgctctgtgcgctggttctctccatttttggcatcgaaacg
cggaaggtgtcgttggaagagatttctgaggtgaattaa

DBGET integrated database retrieval system