KEGG   Escherichia coli K-12 MG1655: b1779Help
Entry
b1779             CDS       T00007                                 

Gene name
gapA
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase A (EC:1.2.1.12)
  KO
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b1779 (gapA)
   01230 Biosynthesis of amino acids
    b1779 (gapA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b1779 (gapA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     b1779 (gapA)
Exosome [BR:eco04147]
 Exosomal proteins
  Proteins found in most exosomes
   b1779 (gapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1862771..1863766
Genome map
AA seq 331 aa AA seqDB search
MTIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEV
KDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMT
GPSKDNTPMFVKGANFDKYAGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHATT
ATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSV
VDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIA
LNDNFVKLVSWYDNETGYSNKVLDLIAHISK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactatcaaagtaggtatcaacggttttggccgtatcggtcgcattgttttccgtgct
gctcagaaacgttctgacatcgagatcgttgcaatcaacgacctgttagacgctgattac
atggcatacatgctgaaatatgactccactcacggccgtttcgacggtaccgttgaagtg
aaagacggtcatctgatcgttaacggtaaaaaaatccgtgttaccgctgaacgtgatccg
gctaacctgaaatgggacgaagttggtgttgacgttgtcgctgaagcaactggtctgttc
ctgactgacgaaactgctcgtaaacacatcaccgctggtgcgaagaaagtggttatgact
ggtccgtctaaagacaacactccgatgttcgttaaaggcgctaacttcgacaaatatgct
ggccaggacatcgtttccaacgcttcctgcaccaccaactgcctggctccgctggctaaa
gttatcaacgataacttcggcatcatcgaaggtctgatgaccaccgttcacgctactacc
gctactcagaaaaccgttgatggcccgtctcacaaagactggcgcggcggccgcggcgct
tcccagaacatcatcccgtcctctaccggtgctgctaaagctgtaggtaaagtactgcca
gaactgaatggcaaactgactggtatggcgttccgcgttccgaccccgaacgtatctgta
gttgacctgaccgttcgtctggaaaaagctgcaacttacgagcagatcaaagctgccgtt
aaagctgctgctgaaggcgaaatgaaaggcgttctgggctacaccgaagatgacgtagta
tctaccgatttcaacggcgaagtttgcacttccgtgttcgatgctaaagctggtatcgct
ctgaacgacaacttcgtgaaactggtatcctggtacgacaacgaaaccggttactccaac
aaagttctggacctgatcgctcacatctccaaataa

DBGET integrated database retrieval system