KEGG   Escherichia coli K-12 MG1655: b1780Help
Entry
b1780             CDS       T00007                                 

Gene name
yeaD
Definition
D-hexose-6-phosphate epimerase-like protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b1780 (yeaD)
Enzymes [BR:eco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     b1780 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1863850..1864734
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHHEDADGVALTFE
LTQSEETKKFWPHDFTLLAHFRVGKTCEIDLESHGEFETTSALHTYFNVGDIAKVSVSGL
GDRFIDKVNDAKENVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSISMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccggtcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtggtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcgtggaaacctgcgggtgaagaagaagttctgtgg
ttgagcaacaacacaccgttcaaaaatggcgtcgctattcgcggtggcgtaccggtttgc
tggccgtggtttggtccggcggcacaacaaggtctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcatgaagatgctgatggcgtagcgctgacttttgaa
ttgacgcaaagcgaagagacgaaaaaattctggccgcacgactttacgctgttagcgcat
ttccgcgtgggtaaaacttgtgaaatcgatcttgaatcacatggcgaatttgaaaccacc
tctgccctgcatacctactttaacgtgggtgatatcgctaaggtaagcgtcagtgggctg
ggcgatcgcttcattgataaagtgaatgacgcgaaagaaaatgtactgaccgatggtatt
cagaccttccctgaccgtaccgatcgcgtgtatctgaatccacaagattgcagcgtgatt
aatgatgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgtc
ggctggaacccgggaccggcgctttcaattagcatgggcgatatgccggatgatggctac
aaaacatttgtttgtgtagaaacggcttacgcttcagaaacgcaaaaagtgaccaaagag
aaacctgcacatctggcgcaatccattcgcgttgcgaaacgttaa

DBGET integrated database retrieval system