KEGG   Escherichia coli K-12 MG1655: b1798Help
Entry
b1798             CDS       T00007                                 

Gene name
leuE
Definition
(RefSeq) leucine efflux protein
  KO
K11250  leucine efflux protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b1798 (leuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE TerC
Motif
Other DBs
NCBI-GeneID: 946157
NCBI-ProteinID: NP_416312
Pasteur: yeaS
RegulonDB: ECK120003571
ECOCYC: G6984
ASAP: ABE-0005984
UniProt: P76249
Position
complement(1880121..1880759)
Genome map
AA seq 212 aa AA seqDB search
MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFL
AWAGVATLIKTTPILFNIVRYLGAFYLLYLGSKILYATLKGKNSEAKSDEPQYGAIFKRA
LILSLTNPKAILFYVSFFVQFIDVNAPHTGISFFILAATLELVSFCYLSFLIISGAFVTQ
YIRTKKKLAKVGNSLIGLMFVGFAARLATLQS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgctgaatacggggttctgaattactggacctatctggttggggccatttttatt
gtgttggtgccagggccaaataccctgtttgtactcaaaaatagcgtcagtagcggtatg
aaaggcggttatcttgcggcctgcggtgtatttattggcgatgcggtattgatgtttctg
gcatgggctggagtggcgacattaattaagaccaccccgatattattcaacattgtacgt
tatcttggtgcgttttatttgctctatctggggagtaaaattctttacgcgaccctgaag
ggtaaaaatagcgaggccaaatccgatgagccccaatacggtgctatttttaaacgcgcg
ttaattttgagcctgactaatccgaaagccattttgttctatgtgtcgtttttcgtacag
tttatcgatgttaatgccccacatacgggaatttcattctttattctggcggcgacgctg
gaactggtgagtttctgctatttgagcttcctgattatatctggtgcttttgtcacgcag
tacatacgtaccaaaaagaaactggctaaagttggcaactcactgattggtttgatgttc
gtgggtttcgctgcccgactggcgacgctgcaatcctga

DBGET integrated database retrieval system