KEGG   Escherichia coli K-12 MG1655: b1805Help
Entry
b1805             CDS       T00007                                 

Gene name
fadD
Definition
(RefSeq) acyl-CoA synthetase (long-chain-fatty-acid--CoA ligase) (EC:6.2.1.3)
  KO
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    b1805 (fadD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    b1805 (fadD)
   00071 Fatty acid degradation
    b1805 (fadD)
Enzymes [BR:eco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     b1805 (fadD)
Lipid biosynthesis proteins [BR:eco01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   b1805 (fadD)
Exosome [BR:eco04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   b1805 (fadD)
  Exosomal proteins of breast cancer cells
   b1805 (fadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1888061..1889746)
Genome map
AA seq 561 aa AA seqDB search
MKKVWLNRYPADVPTEINPDRYQSLVDMFEQSVARYADQPAFVNMGEVMTFRKLEERSRA
FAAYLQQGLGLKKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDS
GASAIVIVSNFAHTLEKVVDKTAVQHVILTRMGDQLSTAKGTVVNFVVKYIKRLVPKYHL
PDAISFRSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNA
TYGPLLHPGKELVVTALPLYHIFALTINCLLFIELGGQNLLITNPRDIPGLVKELAKYPF
TAITGVNTLFNALLNNKEFQQLDFSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLT
ECAPLVSVNPYDIDYHSGSIGLPVPSTEAKLVDDDDNEVPPGQPGELCVKGPQVMLGYWQ
RPDATDEIIKNGWLHTGDIAVMDEEGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHPGV
QEVAAVGVPSGSSGEAVKIFVVKKDPSLTEESLVTFCRRQLTGYKVPKLVEFRDELPKSN
VGKILRRELRDEARGKVDNKA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaggtttggcttaaccgttatcccgcggacgttccgacggagatcaaccctgac
cgttatcaatctctggtagatatgtttgagcagtcggtcgcgcgctacgccgatcaacct
gcgtttgtgaatatgggggaggtaatgaccttccgcaagctggaagaacgcagtcgcgcg
tttgccgcttatttgcaacaagggttggggctgaagaaaggcgatcgcgttgcgttgatg
atgcctaatttattgcaatatccggtggcgctgtttggcattttgcgtgccgggatgatc
gtcgtaaacgttaacccgttgtataccccgcgtgagcttgagcatcagcttaacgatagc
ggcgcatcggcgattgttatcgtgtctaactttgctcacacactggaaaaagtggttgat
aaaaccgccgttcagcacgtaattctgacccgtatgggcgatcagctatctacggcaaaa
ggcacggtagtcaatttcgttgttaaatacatcaagcgtttggtgccgaaataccatctg
ccagatgccatttcatttcgtagcgcactgcataacggctaccggatgcagtacgtcaaa
cccgaactggtgccggaagatttagcttttctgcaatacaccggcggcaccactggtgtg
gcgaaaggcgcgatgctgactcaccgcaatatgctggcgaacctggaacaggttaacgcg
acctatggtccgctgttgcatccgggcaaagagctggtggtgacggcgctgccgctgtat
cacatttttgccctgaccattaactgcctgctgtttatcgaactgggtgggcagaacctg
cttatcactaacccgcgcgatattccagggttggtaaaagagttagcgaaatatccgttt
accgctatcacgggcgttaacaccttgttcaatgcgttgctgaacaataaagagttccag
cagctggatttctccagtctgcatctttccgcaggcggtgggatgccagtgcagcaagtg
gtggcagagcgttgggtgaaactgaccggacagtatctgctggaaggctatggccttacc
gagtgtgcgccgctggtcagcgttaacccatatgatattgattatcatagtggtagcatc
ggtttgccggtgccgtcgacggaagccaaactggtggatgatgatgataatgaagtacca
ccaggtcaaccgggtgagctttgtgtcaaaggaccgcaggtgatgctgggttactggcag
cgtcccgatgctaccgatgaaatcatcaaaaatggctggttacacaccggcgacatcgcg
gtaatggatgaagaaggattcctgcgcattgtcgatcgtaaaaaagacatgattctggtt
tccggttttaacgtctatcccaacgagattgaagatgtcgtcatgcagcatcctggcgta
caggaagtcgcggctgttggcgtaccttccggctccagtggtgaagcggtgaaaatcttc
gtagtgaaaaaagatccatcgcttaccgaagagtcactggtgactttttgccgccgtcag
ctcacgggatacaaagtaccgaagctggtggagtttcgtgatgagttaccgaaatctaac
gtcggaaaaattttgcgacgagaattacgtgacgaagcgcgcggcaaagtggacaataaa
gcctga

DBGET integrated database retrieval system