KEGG   Escherichia coli K-12 MG1655: b1819Help
Entry
b1819             CDS       T00007                                 

Gene name
manZ
Definition
(RefSeq) mannose-specific enzyme IID component of PTS
  KO
K02796  
PTS system, mannose-specific IID component
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    b1819 (manZ)
   00520 Amino sugar and nucleotide sugar metabolism
    b1819 (manZ)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    b1819 (manZ)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component [MD:M00276]
    b1819 (manZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1903895..1904746
Genome map
AA seq 283 aa AA seqDB search
MVDTTQTTTEKKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPENNEA
RKQAIRRHLEFFNTQPFVAAPILGVTLALEEQRANGAEIDDGAINGIKVGLMGPLAGVGD
PIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGYSKGIDIVKDM
GGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQTGKEHVTTVQTILDQLMP
GLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGIAGYACGLLGL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggttgatacaactcaaactaccaccgagaaaaaactcactcaaagtgatattcgtggc
gtcttcctgcgttctaacctcttccagggttcatggaacttcgaacgtatgcaggcactg
ggtttctgcttctctatggtaccggcaattcgtcgcctctaccctgagaacaacgaagct
cgtaaacaagctattcgccgtcacctggagttctttaacacccagccgttcgtggctgcg
ccgattctcggcgtaaccctggcgctggaagaacagcgtgctaatggcgcagagatcgac
gacggtgctatcaacggtatcaaagtcggtttgatggggccactggctggtgtaggcgac
ccgatcttctggggaaccgtacgtccggtatttgcagcactgggtgccggtatcgcgatg
agcggcagcctgttaggtccgctgctgttcttcatcctgtttaacctggtgcgtctggca
acccgttactacggcgtagcgtatggttactccaaaggtatcgatatcgttaaagatatg
ggtggtggcttcctgcaaaaactgacggaaggggcgtctatcctcggcctgtttgtcatg
ggggcattggttaacaagtggacacatgtcaacatcccgctggttgtctctcgcattact
gaccagacgggcaaagaacacgttactactgtccagactattctggaccagttaatgcca
ggcctggtaccactgctgctgacctttgcttgtatgtggctactgcgcaaaaaagttaac
ccgctgtggatcatcgttggcttcttcgtcatcggtatcgctggttacgcttgcggcctg
ctgggactgtaa

DBGET integrated database retrieval system