KEGG   Escherichia coli K-12 MG1655: b1828Help
Entry
b1828             CDS       T00007                                 

Gene name
yebQ
Definition
(RefSeq) putative transporter
  KO
K08169  
MFS transporter, DHA2 family, multidrug resistance protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    b1828 (yebQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1910276..1911649
Genome map
AA seq 457 aa AA seqDB search
MPKVQADGLPLPQRYGAILTIVIGISMAVLDGAIANVALPTIATDLHATPASSIWVVNAY
QIAIVISLLSFSFLGDMFGYRRIYKCGLVVFLLSSLFCALSDSLQMLTLARVIQGFGGAA
LMSVNTALIRLIYPQRFLGRGMGINSFIVAVSSAAGPTIAAAILSIASWKWLFLINVPLG
IIALLLAMRFLPPNGSRASKPRFDLPSAVMNALTFGLLITALSGFAQGQSLTLIAAELVV
MVVVGIFFIRRQLSLPVPLLPVDLLRIPLFSLSICTSVCSFCAQMLAMVSLPFYLQTVLG
RSEVETGLLLTPWPLATMVMAPLAGYLIERVHAGLLGALGLFIMAAGLFSLVLLPASPAD
INIIWPMILCGAGFGLFQSPNNHTIITSAPRERSGGASGMLGTARLLGQSSGAALVALML
NQFGDNGTHVSLMAAAILAVIAACVSGLRITQPRSRA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagttcaggccgacggcctgccattgccccagcgatacggtgcgatattaacc
attgtgattggtatttcgatggccgtccttgacggcgcaatcgccaacgtcgccctgcca
acaatcgccacggaccttcatgccacgccagccagttccatctgggtagtgaacgcctat
caaatcgccattgtcatctccctgctctcgttttcgtttctgggcgatatgtttggctat
cgacgtatttataaatgcggtctggtcgtttttctgttgtcttcactgttctgcgccctt
tctgattcgctgcaaatgctcacccttgcgcgtgtcatacaaggtttcggcggtgcagcg
ttgatgagcgttaataccgcacttatccgcctgatctatccacaacgttttctgggtaga
gggatgggcataaactcgtttattgttgccgtctcttctgctgccgggccgacaattgct
gcagcaatcctctccatcgcatcctggaaatggttatttttaatcaacgtaccgttaggt
attatcgccctgcttctggcgatgcgttttctgccacccaatggttctcgcgccagtaaa
ccccgtttcgacctgcccagcgccgtgatgaacgcgttaaccttcggcctgcttatcact
gcgttgagtggtttcgctcaggggcaatcgctgacgttaattgctgcggaactggtggta
atggttgttgttggtattttctttattcgccgccagctttctcttcccgtaccgctgcta
ccggtggatttactgcgtatcccgctgttttcactttctatttgcacatctgtttgctct
ttctgcgcacaaatgctggcaatggtttccctgcccttttacctgcaaaccgtgctcggg
cgtagtgaagtcgaaacaggtttacttctgacaccgtggccgttagcaacgatggtgatg
gctccgctggcaggctatttgattgaacgcgtacatgcaggattgctgggggctttaggg
ttgttcatcatggctgcggggcttttttccctggttctgctgcccgcgtcacctgcggat
atcaatattatctggccgatgatcttatgtggtgctggatttggcttattccagtcaccc
aataaccacaccattattacctccgcgcctcgcgaacgtagcggtggagccagtggcatg
ttaggaacggctcgtctactgggtcagagtagcggcgcggcgctggtggcgctgatgcta
aatcagtttggagataatggtacacacgtctcgctgatggctgcggctattctggcagtg
attgctgcctgtgtcagtggtttacgtatcactcagccacgatccagggcataa

DBGET integrated database retrieval system