KEGG   Escherichia coli K-12 MG1655: b1830Help
Entry
b1830             CDS       T00007                                 

Gene name
prc
Definition
carboxy-terminal protease for penicillin-binding protein 3 (EC:3.4.21.102)
Orthology
K03797  
carboxyl-terminal processing protease [EC:3.4.21.102]
Organism
eco  Escherichia coli K-12 MG1655
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1912768..1914816)
Genome map
AA seq 682 aa AA seqDB search
MNMFFRLTALAGLLAIAGQTFAVEDITRADQIPVLKEETQHATVSERVTSRFTRSHYRQF
DLDQAFSAKIFDRYLNLLDYSHNVLLASDVEQFAKKKTELGDELRSGKLDVFYDLYNLAQ
KRRFERYQYALSVLEKPMDFTGNDTYNLDRSKAPWPKNEAELNALWDSKVKFDELSLKLT
GKTDKEIRETLTRRYKFAIRRLAQTNSEDVFSLAMTAFAREIDPHTNYLSPRNTEQFNTE
MSLSLEGIGAVLQMDDDYTVINSMVAGGPAAKSKAISVGDKIVGVGQTGKPMVDVIGWRL
DDVVALIKGPKGSKVRLEILPAGKGTKTRTVTLTRERIRLEDRAVKMSVKTVGKEKVGVL
DIPGFYVGLTDDVKVQLQKLEKQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVR
DNNGKVREDSDTDGQVFYKGPLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTV
QQYRSLNRIYDQMLRPEWPALGSVQYTIQKFYRVNGGSTQRKGVTPDIIMPTGNEETETG
EKFEDNALPWDSIDAATYVKSGDLTAFEPELLKEHNARIAKDPEFQNIMKDIARFNAMKD
KRNIVSLNYAVREKENNEDDATRLARLNERFKREGKPELKKLDDLPKDYQEPDPYLDETV
NIALDLAKLEKARPAEQPAPVK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgttttttaggcttaccgcgttagctggcctgcttgcaatagcaggccagacc
ttcgctgtagaagatatcacgcgtgctgatcaaattccggtattaaaggaagagacgcag
catgcgacggtaagtgagcgcgtaacgtcgcgcttcacccgttctcattatcgccagttc
gacctcgatcaggcattttcggccaaaatctttgaccgctacctgaatctgctcgattac
agccacaacgtgctgctggcaagcgatgttgaacagttcgcgaaaaagaaaaccgagtta
ggcgatgaactgcgttcaggcaaactcgacgttttctacgatctctacaatctggcgcaa
aagcgccgttttgagcgttaccagtacgctttgtcggtactggaaaagccgatggatttc
accggcaacgacacttataaccttgaccgcagcaaagcgccctggccgaaaaacgaggct
gagttgaacgcgctgtgggacagtaaagtcaaattcgacgagttaagcctgaagctgaca
ggaaaaacggataaagaaattcgtgaaaccctgactcgccgctacaaatttgccattcgt
cgtctggcgcaaaccaacagcgaagatgttttctcgctggcaatgacggcgtttgcgcgt
gaaatcgacccgcataccaactatctttccccgcgtaataccgaacagttcaacactgaa
atgagtttgtcgctggaaggtattggcgcagtgctgcaaatggatgatgactacaccgtt
atcaattcgatggtggcaggtggtccggcagcgaagagtaaagctatcagcgttggtgac
aaaattgtcggtgttggtcaaacaggcaagccgatggttgacgtgattggctggcgtctt
gatgatgtggttgccttaattaaagggccgaagggcagtaaagttcgtctggaaatttta
cctgctggtaaagggaccaagacccgtactgtaacgttgacccgtgaacgtattcgtctc
gaagaccgcgcggttaaaatgtcggtgaagaccgtcggtaaagagaaagtcggcgtgctg
gatattccgggcttctatgtgggtttgacagacgatgtcaaagtgcaactgcagaaactg
gaaaaacagaatgtcagcagcgtcatcatcgacctgcgtagcaatggcggtggggcgtta
actgaagccgtatcgctctccggtctgtttattcctgcgggtcccattgttcaggtccgc
gataacaacggcaaggttcgtgaagatagcgataccgacggacaggttttctataaaggc
ccgctggtggtgctggttgaccgcttcagtgcttcggcttcagaaatctttgccgcggca
atgcaggattacggtcgtgcgctggttgtgggtgaaccgacgtttggtaaaggcaccgtt
cagcaataccgttcattgaaccgtatttacgatcagatgttacgtcctgaatggccagcg
ctgggttctgtgcagtacacgatccagaaattctatcgcgttaacggcggcagtacgcaa
cgtaaaggcgtaacgccagacatcatcatgccgacgggtaatgaagaaacggaaacgggt
gagaaattcgaagataacgcgctgccgtgggatagcattgatgccgcgacttatgtgaaa
tcaggagatttaacggcctttgaaccggagctgctgaaggaacataatgcgcgtatcgcg
aaagatcctgagttccagaacatcatgaaggatatcgcgcgcttcaacgctatgaaggac
aagcgcaatatcgtttctctgaattacgctgtgcgtgagaaagagaataatgaagatgat
gcgacgcgtctggcgcgtttgaacgaacgctttaaacgcgaaggtaaaccggagttgaag
aaactggatgatctaccgaaagattaccaggagccggatccttatctggatgagacggtg
aatatcgcactcgatctggcgaagcttgaaaaagccagacccgcggaacaacccgctccc
gtcaagtaa

DBGET integrated database retrieval system