KEGG   Escherichia coli K-12 MG1655: b1850Help
Entry
b1850             CDS       T00007                                 

Gene name
eda
Definition
(RefSeq) KHG/KDPG aldolase; 2-dehydro-3-deoxy-phosphogluconate/4-hydroxy-2-oxoglutarate aldolase
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00030  Pentose phosphate pathway
eco00630  Glyoxylate and dicarboxylate metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
eco01200  Carbon metabolism
Module
eco_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
eco_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
eco_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    b1850 (eda)
   00630 Glyoxylate and dicarboxylate metabolism
    b1850 (eda)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     b1850 (eda)
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     b1850 (eda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase HMGL-like
Motif
Other DBs
NCBI-GeneID: 946367
NCBI-ProteinID: NP_416364
Pasteur: eda
RegulonDB: ECK120000250
ECOCYC: EG10256
ASAP: ABE-0006164
UniProt: P0A955
Structure
PDB: 

Jmol
Position
complement(1932115..1932756)
Genome map
AA seq 213 aa AA seqDB search
MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAI
AKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSE
LMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVLC
IGGSWLVPADALEAGDYDRITKLAREAVEGAKL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactggaaaacaagtgcagaatcaatcctgaccaccggcccggttgtaccggtt
atcgtggtaaaaaaactggaacacgcggtgccgatggcaaaagcgttggttgctggtggg
gtgcgcgttctggaagtgactctgcgtaccgagtgtgcagttgacgctatccgtgctatc
gccaaagaagtgcctgaagcgattgtgggtgccggtacggtgctgaatccacagcagctg
gcagaagtcactgaagcgggtgcacagttcgcaattagcccgggtctgaccgagccgctg
ctgaaagctgctaccgaagggactattcctctgattccggggatcagcactgtttccgaa
ctgatgctgggtatggactacggtttgaaagagttcaaattcttcccggctgaagctaac
ggcggcgtgaaagccctgcaggcgatcgcgggtccgttctcccaggtccgtttctgcccg
acgggtggtatttctccggctaactaccgtgactacctggcgctgaaaagcgtgctgtgc
atcggtggttcctggctggttccggcagatgcgctggaagcgggcgattacgaccgcatt
actaagctggcgcgtgaagctgtagaaggcgctaagctgtaa

DBGET integrated database retrieval system