KEGG   Escherichia coli K-12 MG1655: b1850Help
Entry
b1850             CDS       T00007                                 

Gene name
eda
Definition
(RefSeq) multifunctional 2-keto-3-deoxygluconate 6-phosphate aldolase and 2-keto-4-hydroxyglutarate aldolase and oxaloacetate decarboxylase (EC:4.1.2.14 4.1.3.16)
  KO
K01625  
2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pentose phosphate pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b1850 (eda)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    b1850 (eda)
   00630 Glyoxylate and dicarboxylate metabolism
    b1850 (eda)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     b1850 (eda)
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     b1850 (eda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1932115..1932756)
Genome map
AA seq 213 aa AA seqDB search
MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAI
AKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSE
LMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVLC
IGGSWLVPADALEAGDYDRITKLAREAVEGAKL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactggaaaacaagtgcagaatcaatcctgaccaccggcccggttgtaccggtt
atcgtggtaaaaaaactggaacacgcggtgccgatggcaaaagcgttggttgctggtggg
gtgcgcgttctggaagtgactctgcgtaccgagtgtgcagttgacgctatccgtgctatc
gccaaagaagtgcctgaagcgattgtgggtgccggtacggtgctgaatccacagcagctg
gcagaagtcactgaagcgggtgcacagttcgcaattagcccgggtctgaccgagccgctg
ctgaaagctgctaccgaagggactattcctctgattccggggatcagcactgtttccgaa
ctgatgctgggtatggactacggtttgaaagagttcaaattcttcccggctgaagctaac
ggcggcgtgaaagccctgcaggcgatcgcgggtccgttctcccaggtccgtttctgcccg
acgggtggtatttctccggctaactaccgtgactacctggcgctgaaaagcgtgctgtgc
atcggtggttcctggctggttccggcagatgcgctggaagcgggcgattacgaccgcatt
actaagctggcgcgtgaagctgtagaaggcgctaagctgtaa

DBGET integrated database retrieval system