KEGG   Escherichia coli K-12 MG1655: b1861Help
Entry
b1861             CDS       T00007                                 

Gene name
ruvA
Definition
component of RuvABC resolvasome, regulatory subunit (EC:3.1.22.4)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    b1861 (ruvA)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     b1861 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1945365..1945976)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgctggtgttaattgaa
gtgggcggcgtaggctatgaagtgcatatgccgatgacctgtttttatgaactccctgaa
gcgggtcaggaagcgatcgttttcacccactttgtggtgcgtgaagacgcgcaactgctg
tacggttttaacaataaacaagagcgcacattgttcaaagagttgatcaaaaccaacggc
gtcggcccgaagttggcgctggcgatcctctccggaatgtcagcgcagcagttcgttaat
gccgttgagcgtgaagaagtgggggcactggtgaaactgccgggtattggcaaaaaaacc
gccgaacgcttgattgttgaaatgaaagaccgatttaaaggtttgcatggcgatctcttt
acgccagccgccgacctggtactcacgtctcctgccagcccggcgaccgacgatgctgaa
caagaagcggttgccgcgctggtggcgctgggctataaaccacaagaagcaagccgcatg
gtgagcaaaatcgctcgccctgacgccagcagtgaaactttaattcgcgaagccctacgc
gccgcgttatga

DBGET integrated database retrieval system