KEGG   Escherichia coli K-12 MG1655: b1863Help
Entry
b1863             CDS       T00007                                 

Gene name
ruvC
Definition
(RefSeq) component of RuvABC resolvasome, endonuclease (EC:3.1.22.4)
  KO
K01159  
crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    b1863 (ruvC)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     b1863 (ruvC)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     b1863 (ruvC)
    RecFOR pathway proteins
     b1863 (ruvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1946855..1947376)
Genome map
AA seq 173 aa AA seqDB search
MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQ
PDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKS
QVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggctattattctcggcattgatccgggttcgcgcgtgaccggctacggcgtcatccgc
caggtaggtaggcaactgtcctacctgggtagcggatgcatccgcaccaaagtggatgat
ttaccgtctcgtctgaaactcatctatgcgggcgtgacggaaatcatcacccagttccag
cctgattatttcgccattgaacaagtctttatggcaaagaacgctgactcagccctgaaa
ctgggccaggcgcgcggcgtggcgattgtggcggcggtgaatcaggagttgccagtattt
gaatacgcggcacgtcaggtaaagcaaacggtggtaggtattggcagtgccgaaaaaagc
caggtgcagcatatggtccgcaccttgctgaaactgcccgctaatccacaggcggatgcc
gccgatgcgctggcgattgctatcacccactgccacgttagtcagaatgcgatgcagatg
agcgaatcgcggctgaacctggcgagagggcgactgcgttaa

DBGET integrated database retrieval system