KEGG   Escherichia coli K-12 MG1655: b1884Help
Entry
b1884             CDS       T00007                                 

Gene name
cheR
Definition
(RefSeq) chemotaxis regulator, protein-glutamate methyltransferase (EC:2.1.1.80)
  KO
K00575  
chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b1884 (cheR)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    b1884 (cheR)
Enzymes [BR:eco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     b1884 (cheR)
Bacterial motility proteins [BR:eco02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    b1884 (cheR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1968504..1969364)
Genome map
AA seq 286 aa AA seqDB search
MTSSLPCGQTSLLLQMTERLALSDAHFRRISQLIYQRAGIVLADHKRDMVYNRLVRRLRS
LGLTDFGHYLNLLESNQHSGEWQAFINSLTTNLTAFFREAHHFPLLADHARRRSGEYRVW
SAAASTGEEPYSIAMTLADTLGTAPGRWKVFASDIDTEVLEKARSGIYRHEELKNLTPQQ
LQRYFMRGTGPHEGLVRVRQELANYVDFAPLNLLAKQYTVPGPFDAIFCRNVMIYFDQTT
QQEILRRFVPLLKPDGLLFAGHSENFSHLERRFTLRGQTVYALSKD
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatctctgccctgtgggcaaacgtctttattgttacagatgaccgagcgcctg
gcgctttccgacgcgcattttcggcggataagtcaattgatctatcaacgagccgggatc
gttctggctgaccataaacgcgacatggtttacaaccgactggttcgtcgtttgcgttcg
ctgggactgacggatttcggtcattatctgaacttgctggaatctaatcagcacagcggt
gagtggcaggcgtttatcaattcgctgaccacgaatctgacggcatttttccgtgaggca
catcatttccctctgctcgcggatcacgcacgtcgccgttctggcgagtatcgcgtatgg
agcgcggcggcttcgaccggcgaagagccgtacagcattgcgatgacgctggctgacaca
ttgggcaccgcgcccggacgctggaaagtgtttgccagtgatatcgacaccgaagtgctg
gaaaaagccagaagcggtatctatcgccatgaagagttgaaaaacctgacgccgcagcaa
ctgcaacggtatttcatgcgagggacggggccgcatgaagggctggtacgcgtgcgtcag
gagctggcgaactatgttgattttgccccgctgaatctactggcgaaacagtacaccgtg
ccggggccgtttgatgcgatcttctgtcgtaacgtcatgatctacttcgatcaaactacc
cagcaggagattttgcgccgctttgttccgctccttaaacccgacggattgctgtttgcg
ggtcactctgaaaactttagccaccttgagcgccgcttcacgctgcgtggtcagacggtg
tatgcgctaagtaaggattaa

DBGET integrated database retrieval system