KEGG   Escherichia coli K-12 MG1655: b1901Help
Entry
b1901             CDS       T00007                                 

Gene name
araF
Definition
(RefSeq) L-arabinose ABC transporter periplasmic binding protein
  KO
K10537  L-arabinose transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00213  L-Arabinose transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b1901 (araF)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   L-Arabinose transporter [MD:M00213] [OT]
    b1901 (araF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_1 Peripla_BP_4
Motif
Other DBs
NCBI-GeneID: 946409
NCBI-ProteinID: NP_416414
Pasteur: araF
RegulonDB: ECK120000053
ECOCYC: EG10057
ASAP: ABE-0006330
UniProt: P02924
Structure
PDB: 

Jmol
Position
complement(1985139..1986128)
Genome map
AA seq 329 aa AA seqDB search
MHKFTKALAAIGLAAVMSQSAMAENLKLGFLVKQPEEPWFQTEWKFADKAGKDLGFEVIK
IAVPDGEKTLNAIDSLAASGAKGFVICTPDPKLGSAIVAKARGYDMKVIAVDDQFVNAKG
KPMDTVPLVMMAATKIGERQGQELYKEMQKRGWDVKESAVMAITANELDTARRRTTGSMD
ALKAAGFPEKQIYQVPTKSNDIPGAFDAANSMLVQHPEVKHWLIVGMNDSTVLGGVRATE
GQGFKAADIIGIGINGVDAVSELSKAQATGFYGSLLPSPDVHGYKSSEMLYNWVAKDVEP
PKFTEVTDVVLITRDNFKEELEKKGLGGK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaatttactaaagccctggcagccattggtctggcagccgttatgtcacaatcc
gctatggcggagaacctgaagctcggttttctggtgaagcaaccggaagagccgtggttc
cagaccgaatggaagtttgccgataaagccgggaaggatttagggtttgaggttattaag
attgccgtgccggatggcgaaaaaacattgaacgcgatcgacagcctggctgccagtggc
gcaaaaggtttcgttatttgtactccggaccccaaactcggctctgccatcgtcgcgaaa
gcgcgtggctacgatatgaaagtcattgccgtggatgaccagtttgttaacgccaaaggt
aagccaatggataccgttccgctggtgatgatggcggcgactaaaattggcgaacgtcag
ggccaggaactgtataaagagatgcagaaacgtggctgggatgtcaaagaaagcgcggtg
atggcgattaccgccaacgaactggataccgcccgccgccgtactacgggatctatggat
gcgctgaaagcggccggattcccggaaaaacaaatttatcaggtacctaccaaatctaac
gacatcccgggggcatttgacgctgccaactcaatgctggttcaacatccggaagttaaa
cattggctgatcgtcggtatgaacgacagcaccgtgctgggcggcgtacgcgcgacggaa
ggtcagggctttaaagcggccgatatcatcggcattggcattaacggtgtggatgcggtg
agcgaactgtctaaagcacaggcaaccggcttctacggttccctgctgccaagcccggac
gtacatggctataaatccagcgaaatgctttacaactgggtagcaaaagacgttgaaccg
ccaaaatttaccgaagttaccgacgtggtactgatcacgcgtgacaactttaaagaagaa
ctggagaaaaaaggtttaggcggtaagtaa

DBGET integrated database retrieval system