KEGG   Escherichia coli K-12 MG1655: b1902Help
Entry
b1902             CDS       T00007                                 

Gene name
ftnB
Definition
(RefSeq) ferritin B, putative ferrous iron reservoir
  KO
K02255  
ferritin-like protein 2
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1986925..1987428
Genome map
AA seq 167 aa AA seqDB search
MATAGMLLKLNSQMNREFYASNLYLHLSNWCSEQSLNGTATFLRAQAQSNVTQMMRMFNF
MKSVGATPIVKAIDVPGEKLNSLEELFQKTMEEYEQRSSTLAQLADEAKELNDDSTVNFL
RDLEKEQQHDGLLLQTILDEVRSAKLAGMCPVQTDQHVLNVVSHQLH
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgctggaatgcttctcaaactcaactctcaaatgaaccgcgagttttacgca
tccaatctctaccttcacctgagtaactggtgttctgaacagagtctgaacggcaccgcc
actttccttcgcgcccaggcacagagtaatgtgacccaaatgatgcgcatgtttaacttt
atgaagagtgtcggcgctacccccatcgttaaagccattgatgttcccggtgaaaaactg
aactctctggaagaactgttccaaaaaacgatggaagaatacgagcaacgttctagtacg
ttggcacagttagccgatgaagcgaaagaactgaatgatgattcaaccgtcaatttcctg
cgcgatctggaaaaagaacagcagcatgatggtctgttgctgcaaaccattcttgatgaa
gtgcgcagtgcgaaacttgcgggtatgtgccctgtgcagaccgaccaacatgttctgaat
gtcgtgtcacaccagctgcattga

DBGET integrated database retrieval system