KEGG   Escherichia coli K-12 MG1655: b1907Help
Entry
b1907             CDS       T00007                                 

Gene name
tyrP
Definition
(RefSeq) tyrosine transporter
  KO
K03834  
tyrosine-specific transport protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b1907 (tyrP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1989681..1990892
Genome map
AA seq 403 aa AA seqDB search
MKNRTLGSVFIVAGTTIGAGMLAMPLAAAGVGFSVTLILLIGLWALMCYTALLLLEVYQH
VPADTGLGTLAKRYLGRYGQWLTGFSMMFLMYALTAAYISGAGELLASSISDWTGISMSA
TAGVLLFTFVAGGVVCVGTSLVDLFNRFLFSAKIIFLVVMLVLLLPHIHKVNLLTLPLQQ
GLALSAIPVIFTSFGFHGSVPSIVSYMDGNIRKLRWVFIIGSAIPLVAYIFWQVATLGSI
DSTTFMGLLANHAGLNGLLQALREMVASPHVELAVHLFADLALATSFLGVALGLFDYLAD
LFQRSNTVGGRLQTGAITFLPPLAFALFYPRGFVMALGYAGVALAVLALIIPSLLTWQSR
KHNPQAGYRVKGGRPALVVVFLCGIAVIGVQFLIAAGLLPEVG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacagaaccctgggaagtgtttttatcgtggcgggaaccacaattggcgcaggc
atgctggcaatgccgctggctgcggccggtgttggttttagcgttacgttaatcttgttg
attgggctttgggcgttgatgtgctacacggcgctattactgctggaggtgtaccagcat
gttccggcagataccggtctgggcacgctggcaaaacgctatctgggacgctacggtcaa
tggctgacgggcttcagtatgatgttcttaatgtatgctctgactgcggcatacatcagc
ggtgccggtgaattgttggcctccagcatcagcgactggacaggtatttctatgtcggca
accgctggcgtgctgttgttcacttttgttgccggtggcgtggtttgtgtcggaacttca
ctggtcgatttatttaaccgttttctgttcagcgccaagattatttttctggtggtaatg
ctggtactactgctgccgcatattcacaaagtgaatcttttaaccctgccgttgcaacag
gggctggctctgtctgcaatcccggtgatttttacgtcgtttggttttcacggtagcgtg
ccgagtattgtcagctatatggatggcaacattcgtaagctacgctgggtgtttataatc
ggtagtgcgatccccctggtggcatatattttctggcaggtggcgacgcttggcagcatt
gattcaacaacctttatgggattgctggctaatcatgctggattaaacgggctgttacag
gcgttacgcgaaatggtggcctctccgcatgttgagctggcagtgcatttatttgctgat
ttagccctcgccacgtcatttctcggcgttgcgttaggcttatttgattatctggctgat
ttatttcagcgttcaaataccgttggtggacggttgcaaactggtgcaattacgtttctg
ccgccgttggcgtttgcactgttttatccacgaggatttgtgatggcgctgggttacgcc
ggtgtggcgctggcggtactggcattgattatcccttcgctgttgacctggcaaagcaga
aagcacaatcctcaggcgggttaccgggtcaaaggtggtcgtccggcgctggtggtggtg
tttctctgtggtattgctgtgattggcgtgcaatttttgattgcggcagggttgttacca
gaagtggggtga

DBGET integrated database retrieval system