KEGG   Escherichia coli K-12 MG1655: b1918Help
Entry
b1918             CDS       T00007                                 

Gene name
yecS
Definition
(RefSeq) ABC family putative inner membrane permease
  KO
K10009  
cystine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Cystine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b1918 (yecS)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    b1918 (yecS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1997811..1998479)
Genome map
AA seq 222 aa AA seqDB search
MQESIQLVIDSLPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYIS
IFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWE
AAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITS
RTLEVFTMYLAASLIYWIMATVLSTLQNHFENQLNRQEREPK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaagtatacaactggttattgattccttgccgttcctgctgaaaggggctggg
tatacgctgcaactcagtatcggcggcatgttttttggcttactgctcgggtttattctc
gcgctgatgcgtctgtcgccaatctggcccgtgcgctggctggcgcgtttttatatctct
atttttcgtggtacgccgctcatcgcacaactgtttatgatctattacggcctgccgcag
tttggtatcgaattagatcccattccgtcagcaatgattggtctgtcgttgaacactgcc
gcctatgctgccgaaacgctgcgcgccgccatttcttctattgataaaggtcagtgggaa
gcggcagccagtattggtatgacgccgtggcagaccatgcgtcgcgcgattttgccacag
gcggcgcgtgtggcgttgccgccgctgtcgaacagctttattagcctggtaaaagatacg
tcgctggccgcgacaatccaggtgccggagctgttccgtcaggcgcagttgattacctcg
cgtacgctggaggtgttcaccatgtatctggcggcttcgctcatctactggatcatggcg
actgtgttatcgacgttgcagaaccattttgagaatcaacttaatcgccaggagagagaa
ccaaaatga

DBGET integrated database retrieval system