KEGG   Escherichia coli K-12 MG1655: b1919Help
Entry
b1919             CDS       T00007                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase, PLP-dependent (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:eco00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1998494..1999480)
Genome map
AA seq 328 aa AA seqDB search
MPLHNLTRFPRLEFIGAPTPLEYLPRFSDYLGREIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPNAQLEELATRVEAQGFRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVNISSVVVASGSAGTHAGLAVGLEHLMPESELIGVTVSRSVADQLPKVVNLQQAIAK
ELELTASAEILLWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGIS
QKRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcataatttaacccgttttccacggctggagtttatcggcgcgccaacgccg
ctcgaatatctgccgcgcttttctgattatctaggacgggaaattttcatcaaacgggat
gacgtcacccccatggcaatgggcggcaataaattacgtaagctggaatttctcgcggca
gatgctctgcgtgaaggtgccgatacgctgattactgccggggcgatccagtctaaccat
gtgcggcagactgccgcagtcgctgccaaactcggtctgcactgcgtggcgctgctggaa
aatcctattggcacaaccgcagaaaactatttaaccaacggcaatcgcttgttgctggat
ctgttcaatacccagattgaaatgtgcgacgcactgaccgatcccaatgcccaactggaa
gagctggcgacgcgagtcgaagcacaaggctttcgcccgtatgtcattccggttggcggt
tctaatgctcttggcgcgctaggttatgtggagagtgcgctggaaatcgcgcaacagtgt
gaaggggcggttaatatttcatcggtggtagtcgcatcgggcagtgccggaactcacgcc
ggactggctgttgggctggaacacctgatgcctgaaagcgaactgattggcgtgaccgtg
tcgcgttccgttgccgatcaattgccgaaagtggttaacctacaacaggcgattgcgaaa
gaactggagctgaccgcatcagcggaaattttactctgggatgactattttgcacctggc
tacggcgtgccgaacgacgaaggcatggaagcagtgaaattgctggcgcggctggaaggc
attctgcttgatcctgtgtataccggaaaagcgatggcggggctgattgacggtatcagt
cagaaacgcttcaaagatgaagggccgattctgtttattcataccggcggtgcgcctgcg
ctgttcgcctatcatccccacgtttag

DBGET integrated database retrieval system