KEGG   Escherichia coli K-12 MG1655: b1920Help
Entry
b1920             CDS       T00007                                 

Gene name
fliY
Definition
(RefSeq) cystine transporter subunit
  KO
K02424  
cystine transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Cystine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b1920 (fliY)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    b1920 (fliY)
Bacterial motility proteins [BR:eco02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    b1920 (fliY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1999585..2000385)
Genome map
AA seq 266 aa AA seqDB search
MKLAHLGRQALMGVMAVALVAGMSVKSFADEGLLNKVKERGTLLVGLEGTYPPFSFQGDD
GKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDF
STPYTISGIQALVKKGNEGTIKTADDLKGKKVGVGLGTNYEEWLRQNVQGVDVRTYDDDP
TKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVN
DAIAEMQKDGTLQALSEKWFGADVTK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcacatctgggacgtcaggcattgatgggtgtgatggccgtggcgctggtt
gcgggcatgagcgttaaaagttttgcagatgaaggtctgcttaataaagttaaagagcgc
ggcacgctgctggtagggctggaaggaacttatccgccgttcagttttcagggagatgac
ggcaaattaaccggttttgaagtggaatttgcccaacagctggcaaaacatcttggcgtt
gaggcgtcactaaaaccgaccaaatgggacggtatgctggcgtcgctggactctaaacgt
attgatgtggtgattaatcaggtcaccatttctgatgagcgcaagaaaaaatacgatttc
tcaaccccgtacaccatttctggtattcaggcgctggtgaaaaaaggtaacgaaggcacc
attaaaacagccgatgatctgaaaggcaaaaaagtgggggtcggtctgggcaccaactat
gaagagtggctgcggcagaatgttcagggcgtcgatgtgcgtacctatgatgatgacccg
accaaatatcaggatctgcgcgtagggcgtatcgatgcgatcctcgttgatcgtctggcg
gcgctggatctggtgaagaaaaccaacgatacgctggcagtaaccggtgaagcattctcc
cgtcaggagtctggcgtggcgctgcgtaaaggaaatgaggacctgctgaaagcagtgaat
gatgcaattgcggaaatgcaaaaagatggcactctgcaagccctttccgaaaaatggttt
ggtgctgatgtgaccaaataa

DBGET integrated database retrieval system