KEGG   Escherichia coli K-12 MG1655: b1938Help
Entry
b1938             CDS       T00007                                 

Gene name
fliF
Definition
(RefSeq) flagellar basal-body MS-ring and collar protein
  KO
K02409  
flagellar M-ring protein FliF
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eco00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    b1938 (fliF)
Secretion system [BR:eco02044]
 Type III secretion system
  Flagellar export apparatus
   b1938 (fliF)
Bacterial motility proteins [BR:eco02035]
 Flagellar system
  Flagellar assembly proteins
   M,S,P and L rings
    b1938 (fliF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2013229..2014887
Genome map
AA seq 552 aa AA seqDB search
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
LVIRQWINNDHE
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgactgcagcccagacaaaatctcttgagtggcttaatcgcctgcgtgcgaat
ccgaaaattccattgattgttgccggttccgcggcagtggcggtcatggtcgcactgatc
ctgtgggcgaaagcccccgactaccgcacattattcagcaatctttccgatcaggatggt
ggcgcaattgtcagccaactgacgcaaatgaatattccttaccgcttcagcgaagccagc
ggcgctattgaagttccggcagataaagttcacgaactgcgtctgcgcctggcacaacaa
ggtttgccaaaaggcggcgcggtcggtttcgaactgcttgatcaggaaaagtttggtatc
agccagttcagcgaacaggtgaattatcagcgggcgctggaaggcgagctttctcgtacc
atcgaaactatcggcccggtaaaaggggcgcgcgtacatctggcaatgccgaaaccgtct
ttattcgtccgtgaacaaaaatccccttctgcatcggtgacggtaaatctgttacccggc
cgcgcactcgatgaagggcaaattagcgccattgtgcatctggtttccagcgccgttgct
ggtctgccgccgggaaacgtcacgctggtggatcagggcggacatctgttaacccagtcc
aataccagcgggcgcgatcttaatgacgctcagttgaaatatgccagcgatgtcgaaggc
cgtattcagcggcgtattgaagcgatcctgtcgcctattgttggtaacggtaatattcac
gcccaggttacggcgcagctggacttcgccagtaaagaacaaacggaagaacagtatcgc
cctaacggtgatgaatctcatgcggcgcttcgttcacgccagcttaatgagagcgagcaa
agcggttccggttatccgggcggcgtaccgggggcgttgtcgaatcaaccggcacctgcg
aataacgcgccaatcagcacgcctccggcaaatcaaaataaccgccagcagcaggcgagc
accaccagcaatagtgggccgcgtagcacacagcggaatgaaaccagtaactacgaagtc
gatcgcaccattcgtcataccaaaatgaacgtgggcgatgtgcaacgtctgtcagtcgcg
gtcgtggtgaattacaaaaccttgccagatggcaaaccgttgcctctcagcaacgaacag
atgaagcaaattgaagatctgacccgcgaggcgatgggcttttctgaaaaacgcggtgac
tcgctcaatgtcgttaactcgccgttcaatagcagtgacgaaagcggcggagaactgcca
ttctggcaacagcaagcgtttatcgatcagttacttgctgccggtcgctggttgctggta
ctgctggtggcgtggctgctgtggcggaaagcggtacgtccgcagctaacacgtcgcgct
gaggcgatgaaagctgtacagcaacaggcgcaggcccgcgaggaagtggaagatgcggtg
gaagtccgcctgagcaaagacgaacaactacaacaacggcgcgctaaccaacgtctgggg
gcagaagtcatgagccagcgtatccgtgaaatgtctgataacgatccgcgcgtggtggcg
ctggtcattcgccagtggataaataacgatcatgagtaa

DBGET integrated database retrieval system