KEGG   Escherichia coli K-12 MG1655: b1946Help
Entry
b1946             CDS       T00007                                 

Gene name
fliN
Definition
flagellar motor switching and energizing component
Orthology
K02417  
flagellar motor switch protein FliN/FliY
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Bacterial chemotaxis
Flagellar assembly
Class
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:eco02030]
Cellular Processes; Cell motility; Flagellar assembly [PATH:eco02040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2021088..2021501
Genome map
AA seq 137 aa AA seqDB search
MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGGGDVSGTLQDIDLIMDI
PVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGV
RITDIITPSERMRRLSR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatgaataatccggccgatgacaacaacggcgcaatggacgatctgtgggct
gaagcgttgagcgaacaaaaatcaaccagcagcaaaagcgctgccgagacggtgttccag
caatttggcggtggtgatgtcagcggaacgttgcaggatatcgacctgattatggatatt
ccggtcaagctgaccgtcgagctgggccgtacgcggatgaccatcaaagagctgttgcgt
ctgacgcaagggtccgtcgtggcgctggacggtctggcgggcgaaccactggatattctg
atcaacggttatttaatcgcccagggcgaagtggtggtcgttgccgataaatatggcgtg
cggatcaccgatatcattactccgtctgagcgaatgcgccgcctgagccgttag

DBGET integrated database retrieval system