KEGG   Escherichia coli K-12 MG1655: b1946Help
Entry
b1946             CDS       T00007                                 

Gene name
fliN
Definition
flagellar motor switching and energizing component
Orthology
K02417  
flagellar motor switch protein FliN/FliY
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Bacterial chemotaxis
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eco00001]
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    b1946 (fliN)
   02040 Flagellar assembly
    b1946 (fliN)
Secretion system [BR:eco02044]
 Type III secretion system
  Flagellar export apparatus protein
   b1946 (fliN)
Bacterial motility proteins [BR:eco02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    b1946 (fliN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2021088..2021501
Genome map
AA seq 137 aa AA seqDB search
MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGGGDVSGTLQDIDLIMDI
PVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGV
RITDIITPSERMRRLSR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatgaataatccggccgatgacaacaacggcgcaatggacgatctgtgggct
gaagcgttgagcgaacaaaaatcaaccagcagcaaaagcgctgccgagacggtgttccag
caatttggcggtggtgatgtcagcggaacgttgcaggatatcgacctgattatggatatt
ccggtcaagctgaccgtcgagctgggccgtacgcggatgaccatcaaagagctgttgcgt
ctgacgcaagggtccgtcgtggcgctggacggtctggcgggcgaaccactggatattctg
atcaacggttatttaatcgcccagggcgaagtggtggtcgttgccgataaatatggcgtg
cggatcaccgatatcattactccgtctgagcgaatgcgccgcctgagccgttag

DBGET integrated database retrieval system