KEGG   Escherichia coli K-12 MG1655: b1987Help
Entry
b1987             CDS       T00007                                 

Gene name
cbl
Definition
(RefSeq) ssuEADCB/tauABCD operon transcriptional activator
  KO
K13635  
LysR family transcriptional regulator, cys regulon transcriptional activator
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    b1987 (cbl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2059964..2060914)
Genome map
AA seq 316 aa AA seqDB search
MNFQQLKIIREAARQDYNLTEVANMLFTSQSGVSRHIRELEDELGIEIFVRRGKRLLGMT
EPGKALLVIAERILNEASNVRRLADLFTNDTSGVLTIATTHTQARYSLPEVIKAFRELFP
EVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQ
ISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGI
GLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDI
KRQVMESSEEEIDYQI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttccaacaactaaagataatccgcgaggctgcacgtcaggattacaacctgaca
gaggttgcgaatatgctttttacctcacagtcaggcgtcagccgtcatattcgggaactg
gaggatgaacttggcatcgaaatatttgttcgacgaggtaagcgactgctgggcatgact
gaaccgggcaaagcattactggtcattgcagaacgtattctgaatgaagccagtaatgtt
cgtcggcttgcagacctgtttaccaacgatacgtctggcgttctcactattgcaacgacg
catactcaggcacgttatagcttgccagaggtcattaaagcttttcgcgaacttttcccg
gaggttcggctcgagctaatccaggggacgccacaggaaattgcgacattgttgcaaaat
ggcgaagctgatattggtatcgccagcgagcgtttgagtaatgacccgcagctcgtcgcc
ttcccgtggtttcgttggcaccatagtttgcttgttccacacgatcatcccttgacgcaa
atttcaccattgacgctggaatcaatagcgaagtggccgttaatcacttaccgacagggg
attacggggcgctcacgtattgatgacgcatttgcccgcaaaggtttgctggcagatatt
gtattaagtgcgcaggattctgatgtcattaaaacctatgttgctcttgggcttgggatc
ggattagttgccgagcaatccagtggcgaacaagaggaagagaatttaatccgcctggat
acgcggcatctttttgatgctaatactgtctggttgggactgaagcgaggacaacttcag
cgtaactatgtctggcgctttctggaactttgtaatgcaggactgtcagttgaggatatc
aagcggcaggtgatggaaagcagtgaagaggaaattgattatcagatatag

DBGET integrated database retrieval system