KEGG   Escherichia coli K-12 MG1655: b2041Help
Entry
b2041             CDS       T00007                                 

Gene name
rfbB
Definition
dTDP-glucose 4,6 dehydratase, NAD(P)-binding (EC:4.2.1.46)
Orthology
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    b2041 (rfbB)
   01055 Biosynthesis of vancomycin group antibiotics
    b2041 (rfbB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    b2041 (rfbB)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     b2041 (rfbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2111976..2113061)
Genome map
AA seq 361 aa AA seqDB search
MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNRESLADVSDSERYVFEHADIC
DAPAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS
DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA
WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA
RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH
DRRYAIDAEKIGRALGWKPQETFESGIRKTVEWYLSNTKWVDNVKSGAYQSWIEQNYEGR
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatacttgttactggtggcgcaggatttattggttcagctgtagttcgtcacatt
ataaataatacgcaggatagtgttgttaatgtcgataaattaacgtacgccggaaaccgg
gaatcacttgctgatgtttctgattctgaacgctatgtttttgaacatgcggatatttgc
gatgcacctgcaatggcacggatttttgctcagcatcagccggatgcagtgatgcacctg
gctgctgaaagccatgttgaccgttcaattacaggccctgcggcatttattgaaaccaat
attgttggtacttatgtccttttggaagccgctcgcaattactggtctgctcttgatagc
gacaagaaaaatagcttccgttttcatcatatttctactgacgaagtctatggtgatttg
cctcatccagatgaagtaaataatacagaagaattacccttatttactgagacgacagct
tacgcgccaagcagcccttattccgcatccaaagcatccagcgatcatttagtccgcgcg
tggaaacgtacatatggtttaccgacaattgtgactaattgctcgaacaactatggtcct
tatcatttcccggaaaagcttattccactggttattcttaatgcactggaaggtaaggca
ttacctatttatggcaaaggagatcagatccgcgactggttgtatgttgaagatcatgcg
cgtgcgttatataccgtcgtaaccgaaggtaaagcgggtgaaacttataacattggtggg
cacaacgaaaagaaaaacatcgatgtagtgctcactatttgtgatttgctggatgagatt
gtaccgaaagagaaatcttatcgtgagcaaatcacttatgttgctgatcgtccgggacac
gatcgccgctatgctattgatgctgagaagattggtcgcgcattgggatggaaaccacag
gaaacgtttgagagcgggattcgtaaaacggtggaatggtacctgtccaatacaaaatgg
gttgataatgtgaaaagtggtgcctatcaatcgtggattgaacagaactatgagggccgc
cagtaa

DBGET integrated database retrieval system