KEGG   Escherichia coli K-12 MG1655: b2041Help
Entry
b2041             CDS       T00007                                 

Gene name
rfbB
Definition
dTDP-glucose 4,6 dehydratase, NAD(P)-binding (EC:4.2.1.46)
Orthology
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:eco00523]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of vancomycin group antibiotics
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:eco00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2111976..2113061)
Genome map
AA seq 361 aa AA seqDB search
MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNRESLADVSDSERYVFEHADIC
DAPAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS
DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA
WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA
RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH
DRRYAIDAEKIGRALGWKPQETFESGIRKTVEWYLSNTKWVDNVKSGAYQSWIEQNYEGR
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatacttgttactggtggcgcaggatttattggttcagctgtagttcgtcacatt
ataaataatacgcaggatagtgttgttaatgtcgataaattaacgtacgccggaaaccgg
gaatcacttgctgatgtttctgattctgaacgctatgtttttgaacatgcggatatttgc
gatgcacctgcaatggcacggatttttgctcagcatcagccggatgcagtgatgcacctg
gctgctgaaagccatgttgaccgttcaattacaggccctgcggcatttattgaaaccaat
attgttggtacttatgtccttttggaagccgctcgcaattactggtctgctcttgatagc
gacaagaaaaatagcttccgttttcatcatatttctactgacgaagtctatggtgatttg
cctcatccagatgaagtaaataatacagaagaattacccttatttactgagacgacagct
tacgcgccaagcagcccttattccgcatccaaagcatccagcgatcatttagtccgcgcg
tggaaacgtacatatggtttaccgacaattgtgactaattgctcgaacaactatggtcct
tatcatttcccggaaaagcttattccactggttattcttaatgcactggaaggtaaggca
ttacctatttatggcaaaggagatcagatccgcgactggttgtatgttgaagatcatgcg
cgtgcgttatataccgtcgtaaccgaaggtaaagcgggtgaaacttataacattggtggg
cacaacgaaaagaaaaacatcgatgtagtgctcactatttgtgatttgctggatgagatt
gtaccgaaagagaaatcttatcgtgagcaaatcacttatgttgctgatcgtccgggacac
gatcgccgctatgctattgatgctgagaagattggtcgcgcattgggatggaaaccacag
gaaacgtttgagagcgggattcgtaaaacggtggaatggtacctgtccaatacaaaatgg
gttgataatgtgaaaagtggtgcctatcaatcgtggattgaacagaactatgagggccgc
cagtaa

DBGET integrated database retrieval system