KEGG   Escherichia coli K-12 MG1655: b2074Help
Entry
b2074             CDS       T00007                                 

Gene name
mdtA
Definition
(RefSeq) multidrug efflux system, subunit A
  KO
K07799  
membrane fusion protein, multidrug efflux system
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Module
Multidrug resistance, efflux pump MdtABC
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b2074 (mdtA)
Transporters [BR:eco02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   b2074 (mdtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2154016..2155263
Genome map
AA seq 415 aa AA seqDB search
MKGSYKSRWVIVIVVVIAAIAAFWFWQGRNDSRSAAPGATKQAQQSPAGGRRGMRSGPLA
PVQAATAVEQAVPRYLTGLGTITAANTVTVRSRVDGQLIALHFQEGQQVKAGDLLAEIDP
SQFKVALAQAQGQLAKDKATLANARRDLARYQQLAKTNLVSRQELDAQQALVSETEGTIK
ADEASVASAQLQLDWSRITAPVDGRVGLKQVDVGNQISSGDTTGIVVITQTHPIDLVFTL
PESDIATVVQAQKAGKPLVVEAWDRTNSKKLSEGTLLSLDNQIDATTGTIKVKARFNNQD
DALFPNQFVNARMLVDTEQNAVVIPTAALQMGNEGHFVWVLNSENKVSKHLVTPGIQDSQ
KVVIRAGISAGDRVVTDGIDRLTEGAKVEVVEAQSATTPEEKATSREYAKKGARS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtagttataaatcccgttgggtaatcgtaatcgtggtggttatcgccgccatc
gccgcattctggttctggcaaggccgcaatgactcccggagtgcagccccaggggcgacg
aaacaagcgcagcaatcgccagcgggtggtcgacgtggtatgcgttccggcccattagcc
ccggttcaggcggcgaccgccgtagaacaggcagttccgcgttacctcaccgggcttggc
accattaccgccgctaataccgttacggtgcgcagccgcgtggacggccaactgatagcg
ttacatttccaggaaggccagcaggtcaaagcaggcgatttactggcagaaattgacccc
agccagttcaaagttgcattagcacaagcccagggccaactggcaaaagataaagccacg
cttgccaacgcccgccgtgacctggcgcgttatcaacaactggcaaaaaccaatctcgtt
tcccgccaggagctggatgcccaacaggcgctggtcagtgaaaccgaaggcaccattaag
gctgatgaagcaagcgttgccagcgcgcagctgcaactcgactggagccggattaccgca
ccagtcgatggtcgcgttggtctcaagcaggttgatgttggtaaccaaatctccagtggt
gataccaccgggatcgtggtgatcacccagacgcatcctatcgatttagtctttaccctg
ccggaaagcgatatcgctaccgtagtgcaggcgcagaaagccggaaaaccgctggtggta
gaagcctgggatcgcaccaactcgaagaaattaagtgaaggcacgctgttaagtctagat
aaccaaatcgatgccactaccggtacgattaaagtgaaagcacgctttaataatcaggat
gatgcgctgtttcccaatcagtttgttaacgcgcgcatgttagtcgacaccgaacaaaac
gccgtagtgatcccaacagccgccctgcaaatgggcaatgaaggccattttgtctgggtg
ctgaatagcgaaaacaaggtcagcaaacatctggtgacgccgggcattcaggacagtcag
aaagtggtgatccgtgcaggtatttctgcgggcgatcgcgtggtgacagacggcattgat
cgcctgaccgaaggggcgaaagtggaagtggtggaagcccagagcgccactactccggaa
gagaaagccaccagccgcgaatacgcgaaaaaaggagcacgctcctga

DBGET integrated database retrieval system