KEGG   Escherichia coli K-12 MG1655: b2076Help
Entry
b2076             CDS       T00007                                 

Gene name
mdtC
Definition
(RefSeq) multidrug efflux system, subunit C
  KO
K07789  multidrug efflux pump
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02020  Two-component system
Module
eco_M00648  Multidrug resistance, efflux pump MdtABC
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b2076 (mdtC)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b2076 (mdtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF Patched
Motif
Other DBs
NCBI-GeneID: 946608
NCBI-ProteinID: NP_416580
Pasteur: yegO
RegulonDB: ECK120003701
ECOCYC: G7115
ASAP: ABE-0006877
UniProt: P76399
Position
2158386..2161463
Genome map
AA seq 1025 aa AA seqDB search
MKFFALFIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIIVSASLPGASPETMA
SSVATPLERSLGRIAGVSEMTSSSSLGSTRIILQFDFDRDINGAARDVQAAINAAQSLLP
SGMPSRPTYRKANPSDAPIMILTLTSDTYSQGELYDFASTQLAPTISQIDGVGDVDVGGS
SLPAVRVGLNPQALFNQGVSLDDVRTAVSNANVRKPQGALEDGTHRWQIQTNDELKTAAE
YQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPEANIIQTVDSI
RAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTLIISVALVILVVFLFLRSGRATI
IPAVSVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHLEAGMKP
LQAALQGTREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIGISLLVSLT
LTPMMCGWMLKASKPREQKRLRGFGRMLVALQQGYGKSLKWVLNHTRLVGVVLLGTIALN
IWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMRGKLQDFMKIIRDDPAVDNVTGFTG
GSRVNSGMMFITLKPRDERSETAQQIIDRLRVKLAKEPGANLFLMAVQDIRVGGRQSNAS
YQYTLLSDDLAALREWEPKIRKKLATLPELADVNSDQQDNGAEMNLVYDRDTMARLGIDV
QAANSLLNNAFGQRQISTIYQPMNQYKVVMEVDPRYTQDISALEKMFVINNEGKAIPLSY
FAKWQPANAPLSVNHQGLSAASTISFNLPTGKSLSDASAAIDRAMTQLGVPSTVRGSFAG
TAQVFQETMNSQVILIIAAIATVYIVLGILYESYVHPLTILSTLPSAGVGALLALELFNA
PFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRHGNLTPQEAIFQACLLRFRPIMMTTLA
ALFGALPLVLSGGDGSELRQPLGITIVGGLVMSQLLTLYTTPVVYLFFDRLRLRFSRKPK
QTVTE
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttttttgccctcttcatttaccgcccggtggcgacgattttactgtcggttgcc
attaccctgtgcggcatactgggcttccgtatgctgccggtcgccccgctgccgcaggtc
gattttccggtgattatcgtcagcgcctcgctgcccggtgcgtcaccagaaacaatggcg
tcttccgttgccacgccgctggagcgctcacttgggcgcattgccggagtcagtgaaatg
acctccagcagttcgctcggcagcacgcgtattattttgcagtttgattttgaccgggat
atcaacggcgcagcgcgtgatgtgcaggcggcgatcaacgctgcacaaagtttgctgccc
agtgggatgcccagccgcccgacctatcgcaaagcgaacccgtcggatgcgccaattatg
atcctcacgctgacgtccgatacttattcgcagggtgaactgtacgatttcgcctcgacg
cagctggctccgacgatttcgcaaatcgacggtgttggtgatgtcgatgtcggaggcagc
tcactgcccgccgtacgcgtcgggctgaatccgcaggcgctgtttaatcagggcgtgtcg
ctggacgacgtacgcaccgccgtcagcaatgccaacgtgcgtaaaccgcagggcgcgctg
gaagatggcactcaccgctggcagatccagaccaatgatgagctaaaaaccgccgctgaa
tatcagccgttgattattcactacaacaacggcggcgcggttcgtctgggcgatgtggcg
acggtgaccgactcagtgcaggatgtgcgcaacgccgggatgaccaacgccaaaccggct
attttactgatgatccgcaaactgccggaagccaatattatccagacggttgacagcatc
cgggcaaaattaccggagttgcaggaaaccattccggcggcgattgatctgcaaattgcc
caggatcgctcccccaccattcgcgcctcgctggaagaagtcgagcaaacgctgattatc
tcggtggcgctggtgattctggtggtgtttttattcctgcgctcgggtcgcgccactatt
attcccgccgtttcggtgccggtttcgctgattggtacgtttgcggcgatgtacctgtgc
ggattcagtctcaataacctttcgttaatggcgctcaccatcgctactggtttcgtggtg
gatgacgccatcgtggtgctggaaaacattgcacgtcatctggaagcgggaatgaaaccg
ttgcaagccgcactgcaaggtactcgcgaagtcggttttacggtgctgtcgatgagtctg
tcactggtggcggtgttcctgccgctgctgttgatgggcggattgccgggccgactgtta
cgcgaatttgccgtgacgctttctgtcgccattggtatatcgttgctggtttctctgaca
ttaacgccaatgatgtgtggctggatgctgaaagccagcaagccgcgcgagcaaaagcga
ctgcgtggttttggtcgcatgttggtagccctgcaacaaggctacggcaagtcactaaaa
tgggtgctcaatcatacccgtctggtgggcgtggtgctgcttggcaccattgcgctgaat
atctggctgtatatctcgatcccgaaaaccttcttcccggagcaggacactggcgtgttg
atgggcgggattcaggcggatcagagtatttcgtttcaggcgatgcgcggtaagttgcag
gatttcatgaaaattatccgtgacgatccggcagtggataatgtcaccggctttacaggc
ggttcgcgagtgaacagcgggatgatgtttatcaccctcaagccacgcgacgaacgcagc
gaaacggcgcagcaaattatcgaccgtctgcgcgtaaaactggcgaaagaaccgggggcg
aatctgttcctgatggcggtacaggatattcgcgttggtgggcgtcagtcgaacgccagc
taccagtacacgttgttatccgacgacctggcggcactgcgagaatgggagccgaaaatc
cgcaaaaaactggcgacgttgccggaactggcggacgtgaactccgatcagcaggataac
ggcgcggagatgaatctggtttacgaccgcgacaccatggcacggctgggaatcgacgta
caagccgccaacagtctgttaaataacgccttcggtcagcggcaaatctcgaccatttac
cagccgatgaaccagtataaagtggtgatggaagtggatccgcgctatacccaggacatc
agtgcgctggaaaaaatgttcgttatcaataacgaaggcaaagcgatcccgctgtcgtat
ttcgctaaatggcaaccggcgaatgccccactatcggtgaatcatcagggattatcggcg
gcctcgaccatttcgtttaacctgccgaccggaaaatcgctctcggacgccagtgcggcg
atcgatcgcgcaatgacccagcttggtgtgccttcgacggtgcgcggcagttttgccggc
acggcgcaggtgttccaggagacgatgaactcgcaggtgatcctgattatcgccgccatc
gccacggtgtatatcgtgctgggtatcctttacgagagttacgtacatccgctgacgatt
ctctccaccctgccctcggcgggcgttggagcgctgttggcgctggagctgttcaatgcc
ccgttcagcctaatcgccctgatagggatcatgctattaatcggcatcgtgaagaaaaac
gccattatgatggtcgattttgcgcttgaagcccaacggcacggtaacctgacgccgcag
gaagctattttccaggcctgtctgctgcgttttcgcccgattatgatgactaccctggcg
gcgctgtttggtgcgctgccgctggtattgtcgggcggcgacggctcggagctgcggcaa
cccctggggatcaccattgtcggcggactggtaatgagccagctccttacgctgtatacc
acgccggtggtgtatctctttttcgaccgtctgcggctgcgtttttcgcgtaaacctaaa
caaacggtaaccgagtaa

DBGET integrated database retrieval system