KEGG   Escherichia coli K-12 MG1655: b2077Help
Entry
b2077             CDS       T00007                                 

Gene name
mdtD
Definition
(RefSeq) putative arabinose efflux transporter
  KO
K18326  
MFS transporter, DHA2 family, multidrug resistance protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b2077 (mdtD)
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    b2077 (mdtD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2161464..2162879
Genome map
AA seq 471 aa AA seqDB search
MTDLPDSTRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAV
MLPASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGR
LTVMKIVPREQYMAAMTFVTLPGQVGPLLGPALGGLLVEYASWHWIFLINIPVGIIGAIA
TLLLMPNYTMQTRRFDLSGFLLLAVGMAVLTLALDGSKGTGLSPLTIAGLVAVGVVALVL
YLLHARNNNRALFSLKLFRTRTFSLGLAGSFAGRIGSGMLPFMTPVFLQIGLGFSPFHAG
LMMIPMVLGSMGMKRIVVQVVNRFGYRRVLVATTLGLSLVTLLFMTTALLGWYYVLPFVL
FLQGMVNSTRFSSMNTLTLKDLPDNLASSGNSLLSMIMQLSMSIGVTIAGLLLGLFGSQH
VSVDSGTTQTVFMYTWLSMALIIALPAFIFARVPNDTHQNVAISRRKRSAQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcttcccgacagcacccgttggcaattgtggattgtggctttcggcttcttt
atgcagtcgctggacaccaccatcgtaaacaccgcccttccctcaatggcgcaaagcctc
ggggaaagtccgttgcatatgcacatggtcattgtctcttatgtgctgaccgtggcggtg
atgctgcccgccagcggctggctggcggacaaagtcggcgtgcgcaatattttctttacc
gccatcgtgctgtttactctcggttcactgttttgcgcgctttccggcacgctgaacgaa
ctgttgctggcacgcgcgttacagggcgttggcggcgcgatgatggtgccggtcggcaga
ttgacggtgatgaaaatcgtaccgcgcgagcaatatatggcggcgatgacctttgtcacg
ttacccggtcaggtcggtccgctgctcggtccggcgctcggcggtctgctggtggagtac
gcatcgtggcactggatctttttgatcaacattccggtggggattatcggtgcgatcgcc
acattgctgttaatgccgaactacaccatgcagacgcggcgctttgatctctccggattt
ttattgctggcggttggcatggcggtattaaccctggcgctggacggcagtaaaggtaca
ggtttatcgccgctgacgattgcaggcctggtcgcagttggcgtggtggcactggtgctt
tatctgctgcacgccagaaataacaaccgtgccctgttcagtctgaaactgttccgtact
cgtaccttttcgctgggcctggcggggagctttgccggacgtattggcagtggcatgttg
ccctttatgacaccggttttcctgcaaattggcctcggtttctcgccgtttcatgccgga
ctgatgatgatcccgatggtgcttggcagcatgggaatgaagcgaattgtggtacaggtg
gtgaatcgctttggttatcgtcgggtactggtagcgaccacgctgggtctgtcgctggtc
accctgttgtttatgactaccgccctgctgggctggtactacgttttgccgttcgtcctg
tttttacaagggatggtcaactcgacgcgtttctcctccatgaacaccctgacgctgaaa
gatctcccggacaatctggcgagcagcggcaacagcctgctgtcgatgattatgcaattg
tcgatgagtatcggcgtcactatcgccgggctgttgctgggactttttggttcacagcat
gtcagcgtcgacagcggcaccacacaaaccgtctttatgtacacctggcttagcatggcg
ttgatcatcgcccttccggcgttcatctttgccagagtgccgaacgatacgcatcaaaat
gtagctatttcgcggcgaaaaaggagcgcgcaatga

DBGET integrated database retrieval system