KEGG   Escherichia coli K-12 MG1655: b2088Help
Entry
b2088             CDS       T00007                                 

Gene name
insE1
Definition
(RefSeq) IS3 transposase A
  KO
K07483  
transposase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RegulonDB: 
ASAP: 
UniProt: 
Position
2170236..2170535
Genome map
AA seq 99 aa AA seqDB search
MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSS
ERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacagtatcaaccagtaaaaaaccccgtaaacagcattcgcctgaatttcgc
agtgaagccctgaagcttgctgaacgcatcggtgttactgccgcagcccgtgaactcagc
ctgtatgaatcacaactctacaactggcgcagtaaacagcaaaatcagcagacgtcttct
gaacgtgaactggagatgtctaccgagattgcacgtctcaaacgccagctggcagaacgg
gatgaagagctggctatcctccaaaaggccgcgacatacttcgcgaagcgcctgaaatga

DBGET integrated database retrieval system