KEGG   Escherichia coli K-12 MG1655: b2123Help
Entry
b2123             CDS       T00007                                 

Gene name
yehR
Definition
(RefSeq) lipoprotein, DUF1307 family
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1307 DUF3053 LPAM_2
Motif
Other DBs
NCBI-GeneID: 949023
NCBI-ProteinID: NP_416627
Pasteur: yehR
RegulonDB: ECK120001923
ECOCYC: EG12004
ASAP: ABE-0007018
UniProt: P33354
Structure
PDB: 

Jmol
Position
2211225..2211686
Genome map
AA seq 153 aa AA seqDB search
MKAFNKLFSLVVASVLVFSLAGCGDKEESKKFSANLNGTEIAITYVYKGDKVLKQSSETK
IQFASIGATTKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENVTIDMEKVDFKALQG
ISGINVSAEDAKKGITMAQMELVMKAAGFKEVK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcaataagctgttttccctcgttgttgcatctgttctggttttctctctt
gctggctgcggtgacaaagaagaatcgaagaaattcagcgccaatctgaacggcactgaa
attgccattacctatgtctacaaaggtgacaaggtgcttaagcaatcttctgaaaccaaa
attcaatttgcctccattggtgcaaccaccaaagaagatgctgccaagacacttgagccg
ttaagcgccaaatacaaaaacatcgcgggtgttgaagaaaaattaacctataccgatacc
tacgcgcaggaaaacgtgactatcgatatggaaaaagtggattttaaagccctgcagggt
atttcaggaatcaacgtttctgctgaagatgccaaaaaaggtatcactatggcgcaaatg
gaactggtgatgaaagccgctggttttaaagaagtgaaataa

DBGET integrated database retrieval system