KEGG   Escherichia coli K-12 MG1655: b2131Help
Entry
b2131             CDS       T00007                                 

Gene name
osmF
Definition
(RefSeq) putative ABC transporter periplasmic binding protein
  KO
K05845  osmoprotectant transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2131 (osmF)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    b2131 (osmF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OpuAC
Motif
Other DBs
NCBI-GeneID: 946681
NCBI-ProteinID: NP_416635
Pasteur: yehZ
RegulonDB: ECK120001931
ECOCYC: EG12012
ASAP: ABE-0007040
UniProt: P33362
Structure
PDB: 

Jmol
Position
complement(2218564..2219481)
Genome map
AA seq 305 aa AA seqDB search
MPLLKLWAGSLVMLAAVSLPLQAASPVKVGSKIDTEGALLGNIILQVLESHGVPTVNKVQ
LGTTPVVRGAITSGELDIYPEYTGNGAFFFKDENDAAWKNAQQGYEKVKKLDSEHNKLIW
LTPAPANNTWTIAVRQDVAEKNKLTSLADLSRYLQEGGTFKLAASAEFIERADALPAFEK
AYGFKLGQDQLLSLAGGDTAVTIKAAAQQTSGVNAAMAYGTDGPVAALGLQTLSDPQGVQ
PIYAPAPVVRESVLREYPQMAQWLQPVFASLDAKTLQQLNASIAVEGLDAKKVAADYLKQ
KGWTK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccactcttaaagctctgggcaggttcactggttatgttggcagccgtgagcctgccg
ctacaggcggcttcccccgttaaagtcggttcaaaaatcgataccgaaggtgcgctactc
ggcaatatcattttgcaggtgctggaaagccacggcgtaccgacggtgaataaagtgcaa
ctcggaacgactcctgtggtgcgcggggcgattacttccggtgaactggatatctatccg
gaatataccggcaatggcgctttcttctttaaagatgaaaacgatgcagcgtggaaaaac
gcgcagcaaggttacgagaaagtcaaaaagctcgattcggagcacaacaagttaatctgg
ctgacgcccgcgcctgcaaataacacctggactatcgccgtgcgtcaggatgtggcagag
aaaaataaactcacttcgcttgccgacctgagtcgttatctgcaagagggcggcaccttc
aaactggcagcctcggcagagtttatcgaacgcgccgatgcgttacccgcgtttgaaaaa
gcctatggctttaagctcggtcaggatcagttgctgtcactggctggtggcgacacggcg
gtgacgatcaaagccgctgcccagcaaacctctggcgttaatgctgcaatggcttacggc
actgacggcccggtagcggcgctggggctgcaaaccttaagcgatccgcaaggtgtgcaa
cctatctacgcgcctgcaccagtggtgcgtgagtcggtgttgagggagtatccgcaaatg
gcacagtggctacagccagtcttcgccagcctcgatgcaaaaacattgcagcaactgaat
gccagcattgctgtggaaggactggatgccaaaaaagtggctgccgactacctgaaacaa
aaagggtggacgaagtaa

DBGET integrated database retrieval system