KEGG   Escherichia coli K-12 MG1655: b2131Help
Entry
b2131             CDS       T00007                                 

Gene name
osmF
Definition
(RefSeq) putative ABC superfamily transporter periplasmic-binding protein
  KO
K05845  
osmoprotectant transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2131 (osmF)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    b2131 (osmF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2218564..2219481)
Genome map
AA seq 305 aa AA seqDB search
MPLLKLWAGSLVMLAAVSLPLQAASPVKVGSKIDTEGALLGNIILQVLESHGVPTVNKVQ
LGTTPVVRGAITSGELDIYPEYTGNGAFFFKDENDAAWKNAQQGYEKVKKLDSEHNKLIW
LTPAPANNTWTIAVRQDVAEKNKLTSLADLSRYLQEGGTFKLAASAEFIERADALPAFEK
AYGFKLGQDQLLSLAGGDTAVTIKAAAQQTSGVNAAMAYGTDGPVAALGLQTLSDPQGVQ
PIYAPAPVVRESVLREYPQMAQWLQPVFASLDAKTLQQLNASIAVEGLDAKKVAADYLKQ
KGWTK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccactcttaaagctctgggcaggttcactggttatgttggcagccgtgagcctgccg
ctacaggcggcttcccccgttaaagtcggttcaaaaatcgataccgaaggtgcgctactc
ggcaatatcattttgcaggtgctggaaagccacggcgtaccgacggtgaataaagtgcaa
ctcggaacgactcctgtggtgcgcggggcgattacttccggtgaactggatatctatccg
gaatataccggcaatggcgctttcttctttaaagatgaaaacgatgcagcgtggaaaaac
gcgcagcaaggttacgagaaagtcaaaaagctcgattcggagcacaacaagttaatctgg
ctgacgcccgcgcctgcaaataacacctggactatcgccgtgcgtcaggatgtggcagag
aaaaataaactcacttcgcttgccgacctgagtcgttatctgcaagagggcggcaccttc
aaactggcagcctcggcagagtttatcgaacgcgccgatgcgttacccgcgtttgaaaaa
gcctatggctttaagctcggtcaggatcagttgctgtcactggctggtggcgacacggcg
gtgacgatcaaagccgctgcccagcaaacctctggcgttaatgctgcaatggcttacggc
actgacggcccggtagcggcgctggggctgcaaaccttaagcgatccgcaaggtgtgcaa
cctatctacgcgcctgcaccagtggtgcgtgagtcggtgttgagggagtatccgcaaatg
gcacagtggctacagccagtcttcgccagcctcgatgcaaaaacattgcagcaactgaat
gccagcattgctgtggaaggactggatgccaaaaaagtggctgccgactacctgaaacaa
aaagggtggacgaagtaa

DBGET integrated database retrieval system