KEGG   Escherichia coli K-12 MG1655: b2134Help
Entry
b2134             CDS       T00007                                 

Gene name
pbpG
Definition
(RefSeq) D-alanyl-D-alanine endopeptidase
  KO
K07262  
D-alanyl-D-alanine endopeptidase (penicillin-binding protein 7) [EC:3.4.21.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     b2134 (pbpG)
Peptidases [BR:eco01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   b2134 (pbpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2223938..2224870)
Genome map
AA seq 310 aa AA seqDB search
MPKFRVSLFSLALMLAVPFAPQAVAKTAAATTASQPEIASGSAMIVDLNTNKVIYSNHPD
LVRPIASISKLMTAMVVLDARLPLDEKLKVDISQTPEMKGVYSRVRLNSEISRKDMLLLA
LMSSENRAAASLAHHYPGGYKAFIKAMNAKAKSLGMNNTRFVEPTGLSVHNVSTARDLTK
LLIASKQYPLIGQLSTTREDMATFSNPTYTLPFRNTNHLVYRDNWNIQLTKTGFTNAAGH
CLVMRTVINNKPVALVVMDAFGKYTHFADASRLRTWIETGKVMPVPAAALSYKKQKAAQM
AAAGQTAQND
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaatttcgagtttctttatttagcctggccctgatgctggctgtgccttttgca
ccgcaggccgttgcgaaaacggcagccgctaccaccgcttcacaaccggaaattgcctcc
ggtagcgcgatgattgttgatctgaataccaacaaagtgatctattcgaaccacccggat
ctggtgcgtccgattgcgtctatcagcaaattaatgaccgcgatggttgtgctggatgca
cgactgccgctggatgaaaaactaaaagtggatatcagccagacgccggagatgaaaggg
gtctattcgcgcgtacgactgaatagcgaaatcagccgtaaagatatgctgttgctggcg
ctgatgtcttcagaaaaccgcgcggcggcaagccttgcgcaccattatcccggtggttac
aaagcctttattaaggcaatgaatgcgaaagcgaaatcgctcggaatgaacaacacgcgc
tttgttgaacctaccggattgtcggtgcataacgtttcaactgcccgtgacttaaccaaa
ctgctcattgccagcaaacaatatccgttgatcgggcagttaagtactacccgggaagat
atggcaaccttctctaatccgacgtatacgctgccgttccgcaatactaatcatctggtg
tatcgcgataactggaatattcagttaaccaaaaccggctttaccaatgcggcgggccat
tgtctggtgatgcgtacggttatcaataataaaccggtggcgctggtagtgatggacgcg
tttggcaaatatacccattttgccgatgccagccgcctgcgtacctggattgaaaccggt
aaagtgatgcctgtgccggcagcagcgttgagctataaaaaacaaaaagccgcccaaatg
gcggcggcggggcagacggcacagaacgattaa

DBGET integrated database retrieval system