KEGG   Escherichia coli K-12 MG1655: b2144Help
Entry
b2144             CDS       T00007                                 

Gene name
sanA
Definition
(RefSeq) vancomycin high temperature exclusion protein, DUF218 superfamily protein
  KO
K03748  
SanA protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2232878..2233597
Genome map
AA seq 239 aa AA seqDB search
MLKRVFLSLLVLIGLLLLTVLGLDRWMSWKTAPYIYDELQDLPYRQVGVVLGTAKYYRTG
VINQYYRYRIQGAINAYNSGKVNYLLLSGDNALQSYNEPMTMRKDLIAAGVDPSDIVLDY
AGFRTLDSIVRTRKVFDTNDFIIITQRFHCERALFIALHMGIQAQCYAVPSPKDMLSVRI
REFAARFGALADLYIFKREPRFLGPLVPIPAMHQVPEDAQGYPAVTPEQLLELQKKQGK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcgcgtgttcctcagcctgttagtcctgatcggcttgctgctgttgactgtg
ctcggcctcgatcgctggatgagctggaaaaccgcgccttatatctacgacgaattgcag
gatctcccctaccgccaggtcggtgtggtgctcggaacagcaaaatattatcgtactggc
gtaattaatcagtattatcgctaccgcattcaaggagcgattaatgcctataacagcggt
aaggtaaattatctattactgagcggcgataacgcattgcaaagttataatgagccgatg
accatgcgcaaagatttaatcgctgctggtgtcgacccatcagatattgttctcgattac
gcaggctttcgtacgctggattccatcgtgcgtacacgcaaagttttcgatactaatgat
ttcattattatcacccaacgtttccactgtgagcgagcattatttattgcgctgcatatg
gggattcaggctcagtgttatgccgtaccgtcaccgaaagatatgctgtcagtacgtatt
cgtgaatttgccgcccgtttcggtgcgctggctgacctttatatttttaaacgtgaaccg
cgttttttagggccgctggtccctattccggctatgcaccaggtaccggaagatgcgcag
gggtatcccgccgtcacacccgaacagttacttgaattacaaaagaaacaaggaaagtag

DBGET integrated database retrieval system