KEGG   Escherichia coli K-12 MG1655: b2150Help
Entry
b2150             CDS       T00007                                 

Gene name
mglB
Definition
(RefSeq) methyl-galactoside transporter subunit
  KO
K10540  
methyl-galactoside transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Bacterial chemotaxis
Module
Methyl-galactoside transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2150 (mglB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    b2150 (mglB)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Methyl-galactoside transporter [MD:M00214] [OT]
    b2150 (mglB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2239350..2240348)
Genome map
AA seq 332 aa AA seqDB search
MNKKVLTLSAVMASMLFGAAAHAADTRIGVTIYKYDDNFMSVVRKAIEQDAKAAPDVQLL
MNDSQNDQSKQNDQIDVLLAKGVKALAINLVDPAAAGTVIEKARGQNVPVVFFNKEPSRK
ALDSYDKAYYVGTDSKESGIIQGDLIAKHWAANQGWDLNKDGQIQFVLLKGEPGHPDAEA
RTTYVIKELNDKGIKTEQLQLDTAMWDTAQAKDKMDAWLSGPNANKIEVVIANNDAMAMG
AVEALKAHNKSSIPVFGVDALPEALALVKSGALAGTVLNDANNQAKATFDLAKNLADGKG
AADGTNWKIDNKVVRVPYVGVDKDNLAEFSKK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaggtgttaaccctgtctgctgtgatggccagcatgttattcggtgccgct
gcacacgctgctgatactcgcattggtgtaacaatctataagtacgacgataactttatg
tctgtagtgcgcaaggctattgagcaagatgcgaaagccgcgccagatgttcagctgctg
atgaatgattctcagaatgaccagtccaagcagaacgatcagatcgacgtattgctggcg
aaaggggtgaaggcactggcaatcaacctggttgacccggcagctgcgggtacggtgatt
gagaaagcgcgtgggcaaaacgtgccggtggttttcttcaacaaagaaccgtctcgtaag
gcgctggatagctacgacaaagcctactacgttggcactgactccaaagagtccggcatt
attcaaggcgatttgattgctaaacactgggcggcgaatcagggttgggatctgaacaaa
gacggtcagattcagttcgtactgctgaaaggtgaaccgggccatccggatgcagaagca
cgtaccacttacgtgattaaagaattgaacgataaaggcatcaaaactgaacagttacag
ttagataccgcaatgtgggacaccgctcaggcgaaagataagatggacgcctggctgtct
ggcccgaacgccaacaaaatcgaagtggttatcgccaacaacgatgcgatggcaatgggc
gcggttgaagcgctgaaagcacacaacaagtccagcattccggtgtttggcgtcgatgcg
ctgccagaagcgctggcgctggtgaaatccggtgcactggcgggcaccgtactgaacgat
gctaacaaccaggcgaaagcgacctttgatctggcgaaaaacctggccgatggtaaaggt
gcggctgatggcaccaactggaaaatcgacaacaaagtggtccgcgtaccttatgttggc
gtagataaagacaacctggctgaattcagcaagaaataa

DBGET integrated database retrieval system