KEGG   Escherichia coli K-12 MG1655: b2155Help
Entry
b2155             CDS       T00007                                 

Gene name
cirA
Definition
(RefSeq) colicin IA outer membrane receptor and translocator; ferric iron-catecholate transporter
  KO
K16089  
outer membrane receptor for ferrienterochelin and colicins
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b2155 (cirA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2244778..2246769)
Genome map
AA seq 663 aa AA seqDB search
MFRLNPFVRVGLCLSAISCAWPVLAVDDDGETMVVTASSVEQNLKDAPASISVITQEDLQ
RKPVQNLKDVLKEVPGVQLTNEGDNRKGVSIRGLDSSYTLILVDGKRVNSRNAVFRHNDF
DLNWIPVDSIERIEVVRGPMSSLYGSDALGGVVNIITKKIGQKWSGTVTVDTTIQEHRDR
GDTYNGQFFTSGPLIDGVLGMKAYGSLAKREKDDPQNSTTTDTGETPRIEGFSSRDGNVE
FAWTPNQNHDFTAGYGFDRQDRDSDSLDKNRLERQNYSVSHNGRWDYGTSELKYYGEKVE
NKNPGNSSPITSESNTVDGKYTLPLTAINQFLTVGGEWRHDKLSDAVNLTGGTSSKTSAS
QYALFVEDEWRIFEPLALTTGVRMDDHETYGEHWSPRAYLVYNATDTVTVKGGWATAFKA
PSLLQLSPDWTSNSCRGACKIVGSPDLKPETSESWELGLYYMGEEGWLEGVESSVTVFRN
DVKDRISISRTSDVNAAPGYQNFVGFETGANGRRIPVFSYYNVNKARIQGVETELKIPFN
DEWKLSINYTYNDGRDVSNGENKPLSDLPFHTANGTLDWKPLALEDWSFYVSGHYTGQKR
ADSATAKTPGGYTIWNTGAAWQVTKDVKLRAGVLNLGDKDLSRDDYSYNEDGRRYFMAVD
YRF
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggttgaaccctttcgtacgggtcgggctgtgtttgtccgctatttcttgtgca
tggcctgtgttagcggtcgatgatgatggcgaaacgatggttgtcactgcatcttccgtg
gaacaaaatcttaaagatgcacctgccagtatcagcgtcattacccaggaagacctgcag
cgaaaaccggtacagaatctgaaggatgtcctcaaagaagtgcctggcgtacaactgacg
aacgaaggggataaccgtaagggcgttagtattcgtggtctggacagcagctataccctg
attctcgtcgacggtaaacgcgtgaactcccgcaatgccgtcttccgccacaatgatttc
gatctgaactggatcccggtcgattccatcgaacgtattgaagtggtccgtggcccgatg
tcgtcgctgtacggttccgatgcgctcggcggtgtagtgaatatcatcaccaaaaaaatc
ggtcagaaatggtcgggtaccgttaccgtcgataccaccattcaggaacatcgcgatcgc
ggtgacacctataacggtcagttctttaccagtggaccattaattgatggtgtgctggga
atgaaagcttacggcagcctggcaaaacgtgaaaaggatgacccgcaaaactcaacgacc
accgataccggagaaacgccgcgtattgaaggattctccagccgcgacggcaatgtcgaa
tttgcctggacaccgaatcaaaatcacgattttactgccggatacggtttcgaccgtcag
gatcgtgattccgactcgctggacaaaaaccgcctggaacgccagaactactccgtcagc
cataatgggcgttgggattacggcaccagcgaactgaaatactacggtgagaaagtcgag
aacaaaaaccctggcaacagcagcccgataacttccgaaagcaatacggtcgacggcaaa
tacacgttgccgctgacggcgattaatcagtttctcacggttggcggtgaatggcgtcac
gacaaacttagcgatgcggtgaacctgaccgggggaaccagctccaaaacgtctgccagc
cagtacgcgctgtttgtggaagatgaatggcggatcttcgagccgctggcgctgacgacc
ggcgtgcgtatggacgatcacgaaacctacggtgaacactggagtccgcgtgcctacctg
gtttataacgccaccgacaccgtaacggtgaaagggggctgggcgacggcatttaaagca
ccttctctgttgcaacttagccctgactggacgagcaattcctgccgtggcgcatgtaag
attgtgggtagcccggatctgaaaccagaaaccagcgaaagttgggagctggggctttac
tacatgggtgaagaaggctggctggaaggggttgaatccagcgttaccgttttccgtaac
gatgtgaaagatcgtatcagcatcagccgtacgtctgacgtcaacgctgcaccgggctac
caaaactttgttggttttgagacgggcgctaacggacggcgcataccggtatttagctac
tacaacgttaacaaagctcgtattcagggcgtggaaaccgaactgaaaattccgttcaac
gatgaatggaaactgtcgatcaactacacctacaacgatggtcgtgatgtcagcaacggc
gaaaacaaaccgctatccgatctgccgttccatactgctaacggtacgctggactggaaa
ccgctggcgctggaagactggtcattctatgtttctgggcactataccgggcagaaacgc
gccgacagcgcgacggctaaaacaccgggcggttataccatctggaataccggcgcggcc
tggcaggtgactaaagacgtcaaactgcgcgcaggcgtgctgaaccttggcgacaaggat
ctcagtcgtgacgactacagctataacgaagacggacgtcgttactttatggcagtggat
tatcgcttctga

DBGET integrated database retrieval system