KEGG   Escherichia coli K-12 MG1655: b2157Help
Entry
b2157             CDS       T00007                                 

Gene name
yeiE
Definition
(RefSeq) putative DNA-binding transcriptional regulator
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 PBP_like PBP_like_2 Phosphonate-bd
Motif
Other DBs
NCBI-GeneID: 946657
NCBI-ProteinID: NP_416662
Pasteur: yeiE
RegulonDB: ECK120002010
ECOCYC: EG12105
ASAP: ABE-0007138
UniProt: P0ACR4
Position
complement(2248737..2249618)
Genome map
AA seq 293 aa AA seqDB search
MHITLRQLEVFAEVLKSGSTTQASVMLALSQSAVSAALTDLEGQLGVQLFDRVGKRLVVN
EHGRLLYPRALALLEQAVEIEQLFREDNGAIRIYASSTIGNYILPAVIARYRHDYPQLPI
ELSVGNSQDVMQAVLDFRVDIGFIEGPCHSTEIISEPWLEDELVVFAAPTSPLARGPVTL
EQLAAAPWILRERGSGTREIVDYLLLSHLPKFEMAMELGNSEAIKHAVRHGLGISCLSRR
VIEDQLQAGTLSEVAVPLPRLMRTLWRIHHRQKHLSNALRRFLDYCDPANVPR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcaccctccggcagttggaagtttttgcagaagtattgaaaagtggatcaacc
acccaggcgtcggtgatgctggcgttgtcgcaatcagcagtgagcgcagccttgaccgac
ctggaagggcagcttggcgtgcaactgtttgatcgcgtggggaaaagactggttgttaat
gaacacgggcggctgctctatccgcgtgcgttggcattgcttgaacaggcggttgaaatc
gaacaactgtttcgcgaagacaacggcgcgattcgtatctatgccagtagtaccatcggt
aactacattctgcctgcagttatcgcccgttatcgccatgattatccgcagttgccgatt
gaacttagcgttgggaatagccaggacgtgatgcaagcggtgctggatttccgcgttgat
attggctttattgaaggaccgtgccacagcactgaaatcatttctgaaccgtggctggaa
gacgagctggtggttttcgccgcgccgacttcgccgttggcccgtggtccggtcacctta
gaacagctggccgctgcgccgtggatcctgcgtgaacgcggttccggcacgcgggagatt
gtcgattatctgttgctgtcacatttaccgaagtttgagatggcgatggaattaggtaac
tccgaggcaatcaaacatgcggtgcgtcatgggttgggaattagttgcctgtcgcgacgt
gtgattgaagatcaattgcaggcaggcacattaagtgaagttgcggtccctctgccgcgc
ctgatgcgtacgttgtggcgtatacatcatcggcaaaaacacctttccaacgcgctacgg
cgctttctggactattgcgatcccgcaaatgtgccgcgttaa

DBGET integrated database retrieval system